BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0664 (487 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64834-2|AAB04823.2| 1145|Caenorhabditis elegans Hypothetical pr... 27 5.5 Z81470-1|CAB03881.1| 321|Caenorhabditis elegans Hypothetical pr... 27 9.5 >U64834-2|AAB04823.2| 1145|Caenorhabditis elegans Hypothetical protein F54D11.2 protein. Length = 1145 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 211 RSSHQRXPNAAAAGQQPSVADRAPSTLVPGVSTNEDLSCQTSDGQE 348 +S+ +R ++ +PS + APS VPG S D + + + E Sbjct: 104 KSASKRKSSSLMNKDEPSTSTEAPSADVPGTSEASDEASEIQEAPE 149 >Z81470-1|CAB03881.1| 321|Caenorhabditis elegans Hypothetical protein C14A6.1 protein. Length = 321 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 135 LLLIGFLAAACAQNMDTGDL 194 LLL G L AA AQN +TG + Sbjct: 6 LLLFGLLGAATAQNCNTGGI 25 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,550,548 Number of Sequences: 27780 Number of extensions: 130488 Number of successful extensions: 272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -