BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0663 (788 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 26 0.39 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.1 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.8 bits (54), Expect = 0.39 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 324 KSLILFPERFKCASFLQPLRKVSHL 250 ++ I+FP F CA L PL+ +L Sbjct: 303 RAFIIFPTHFYCAFSLYPLKSTFYL 327 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.4 bits (48), Expect = 2.1 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 81 VKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLE 230 ++ LNLD + + +T T L+ LSL +TTL L +LE Sbjct: 492 LRYLNLDYNDLSAVPIVTHSLTELRHLSLEGNPITTLSNTSLLGAANQLE 541 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 278 KKLAHLNLSGNKI 316 K L LNL GNKI Sbjct: 140 KSLKRLNLKGNKI 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,326 Number of Sequences: 336 Number of extensions: 2464 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -