BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0662 (881 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCPB16A4.06c |||sequence orphan|Schizosaccharomyces pombe|chr 3... 28 1.5 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 28 2.0 SPAC31G5.06 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 4.7 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.2 SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomy... 26 6.2 >SPCPB16A4.06c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 126 Score = 28.3 bits (60), Expect = 1.5 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -2 Query: 376 PPPRCRDHSIHRGGIRESASRYDS*PRGSHLGPQAVHNREH 254 PP R R+ ++ R G R SA + R GPQ + EH Sbjct: 27 PPRRWRNCTLQRHGSRASADEFCEQYRSRSHGPQGRRSLEH 67 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 27.9 bits (59), Expect = 2.0 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = -1 Query: 407 SSTGKSLKTATSSTMPRSLNTSRRNS*VSKPIRFVASRVTPRTSSGS 267 SST S +SS SLN++ + S I S TP TSS S Sbjct: 214 SSTAASNSATSSSLASSSLNSTTSATATSSSISSTVSSSTPLTSSNS 260 >SPAC31G5.06 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 234 Score = 26.6 bits (56), Expect = 4.7 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -2 Query: 319 SRYDS*PRGSHLGPQAVHNREHGKDLSLAVYLFDEYLQ 206 +R D+ PR L P N H K +SL L D YLQ Sbjct: 41 ARKDTNPRKFCLLPLEGKNHLHNKHVSLYCLLSDRYLQ 78 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 26.2 bits (55), Expect = 6.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 357 ITQYIEEEFVSQQADTIRSLAGHTSDLKRFITENTGKTCL 238 I Q +++FV + + L + + KR +TEN G T L Sbjct: 327 IRQLEQQKFVEIASQRAKELDVYMEEFKRSLTENNGFTTL 366 >SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomyces pombe|chr 2|||Manual Length = 542 Score = 26.2 bits (55), Expect = 6.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 392 TSLWMKKILSASCFCVSKALARAPISWPTS 481 +++W I A C C++ ++A ++PTS Sbjct: 95 SAVWCWLIAGAGCMCIALSVAELVSAYPTS 124 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,442,730 Number of Sequences: 5004 Number of extensions: 66915 Number of successful extensions: 142 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 442483990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -