BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0662 (881 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 6e-18 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 8e-18 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 83 4e-16 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 82 7e-16 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 81 2e-15 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 80 3e-15 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 79 4e-15 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 79 4e-15 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 79 4e-15 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 79 5e-15 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 78 8e-15 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 78 8e-15 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 8e-15 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 78 1e-14 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 77 1e-14 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 77 1e-14 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 77 1e-14 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 77 1e-14 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 77 1e-14 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 77 1e-14 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 77 1e-14 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 77 1e-14 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 77 1e-14 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 77 1e-14 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 77 1e-14 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 77 1e-14 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 77 1e-14 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 77 1e-14 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 77 1e-14 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 77 1e-14 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 77 1e-14 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 77 1e-14 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 77 1e-14 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 77 1e-14 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 77 1e-14 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 77 1e-14 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 77 1e-14 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 77 1e-14 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 77 1e-14 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 77 1e-14 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 77 1e-14 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 77 1e-14 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 77 1e-14 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 77 1e-14 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 77 1e-14 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 77 1e-14 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 77 1e-14 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 77 1e-14 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 77 1e-14 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 77 1e-14 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 77 1e-14 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 77 1e-14 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 77 1e-14 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 77 1e-14 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 77 1e-14 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 77 1e-14 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 77 1e-14 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 77 1e-14 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 77 2e-14 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 3e-14 SB_14| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 3e-14 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 76 3e-14 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 76 3e-14 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 76 3e-14 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 76 3e-14 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 76 3e-14 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 76 3e-14 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 76 3e-14 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 76 3e-14 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 76 3e-14 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 76 3e-14 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 76 3e-14 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 76 3e-14 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 76 3e-14 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 76 3e-14 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 76 3e-14 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 76 3e-14 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 76 3e-14 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 76 3e-14 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 76 3e-14 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 76 3e-14 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 76 3e-14 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 76 3e-14 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 76 3e-14 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 76 3e-14 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 76 3e-14 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 76 3e-14 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 76 3e-14 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 76 3e-14 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 76 3e-14 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 76 3e-14 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 76 3e-14 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 76 3e-14 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 76 3e-14 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 92.3 bits (219), Expect = 5e-19 Identities = 42/59 (71%), Positives = 45/59 (76%) Frame = -1 Query: 719 CATVGKGESVRAFFAITPAGERGMCCKAIKXGNARVFPVTTL*NDGPVNCNTTHYRANW 543 CATVGKG+ FAITPAGERGMCCKAIK GNA+ FP + PVNCNTTHYRANW Sbjct: 2 CATVGKGDRC-GLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 88.6 bits (210), Expect = 6e-18 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +3 Query: 558 VSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 +SRITIHW VLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 318 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 88.2 bits (209), Expect = 8e-18 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +3 Query: 546 IRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 IRPIVSRITIHW +RRDWENPGV LNRLAAHPPFASWR+SEE Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEE 63 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 83.0 bits (196), Expect = 3e-16 Identities = 38/54 (70%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -1 Query: 701 GESVRA-FFAITPAGERGMCCKAIKXGNARVFPVTTL*NDGPVNCNTTHYRANW 543 G ++ A FAITPAGERGMCCKAIK GNA VFP + PVNCNTTHYRANW Sbjct: 14 GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/51 (43%), Positives = 26/51 (50%) Frame = -3 Query: 732 FAIQXRNCWXGRIGAGLLRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRP 580 FAIQ IGAGL + +G + +G FPSHDVVKRRP Sbjct: 5 FAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRP 55 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 82.6 bits (195), Expect = 4e-16 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = -1 Query: 680 FAITPAGERGMCCKAIKXGNARVFPVTTL*NDGPVNCNTTHYRANW 543 FAITPAGERGMCCKAIK GNA VFP + PVNCNTTHYRANW Sbjct: 8 FAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 696 IGAGLLRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRP 580 IGAGL + +G + +G FPSHDVVKRRP Sbjct: 3 IGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRP 41 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 81.8 bits (193), Expect = 7e-16 Identities = 37/53 (69%), Positives = 40/53 (75%) Frame = +3 Query: 525 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 RGG P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 95 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 81.8 bits (193), Expect = 7e-16 Identities = 36/55 (65%), Positives = 41/55 (74%) Frame = +3 Query: 519 VTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 + +GG P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 49 IAQGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 103 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 81.4 bits (192), Expect = 9e-16 Identities = 39/49 (79%), Positives = 42/49 (85%) Frame = +1 Query: 586 SFYNVVTGKTLALPXLIALQHIPLSPAGVIAKKARTDSPXPTVAXLNGE 732 SFYNVVTGKTLALP LIALQHIPLSPAGVIA++ARTD P + LNGE Sbjct: 46 SFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGE 94 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +3 Query: 546 IRPIVSRITIHW 581 +RP+VSRITIHW Sbjct: 33 LRPVVSRITIHW 44 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 80.6 bits (190), Expect = 2e-15 Identities = 36/51 (70%), Positives = 37/51 (72%) Frame = +3 Query: 591 LQRRDWENPGVTXLNRLAAHPPFASWRNSEEGPHRFALXNSCAXEWRXGXL 743 LQRRDWENPGVT LNRLAAHPPFASWRNSE PHR EWR G + Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQPEWRMGLM 397 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +1 Query: 583 PSFYNVVTGKTLALPXLIALQHIPLSPAGVIAKKARTDSPXPTVAXLNGE 732 PSFYNVVTGKTLALP LIALQHIPLSPAGV +++ARTD P + LNGE Sbjct: 9 PSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGE 58 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 79.8 bits (188), Expect = 3e-15 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = +3 Query: 528 GGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G +YP ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 68 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 79.4 bits (187), Expect = 4e-15 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +3 Query: 507 LQCGVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 L GV R G P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 15 LHPGVIRDGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 71 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 79.4 bits (187), Expect = 4e-15 Identities = 38/56 (67%), Positives = 41/56 (73%) Frame = +3 Query: 516 GVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G TRG P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 67 GYTRGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 119 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 79.4 bits (187), Expect = 4e-15 Identities = 36/59 (61%), Positives = 41/59 (69%) Frame = +3 Query: 507 LQCGVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 L C + + P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 69 LHCSINQRLLGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 127 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 79.4 bits (187), Expect = 4e-15 Identities = 37/56 (66%), Positives = 41/56 (73%) Frame = +3 Query: 516 GVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G +GG P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 34 GTAKGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 87 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 79.4 bits (187), Expect = 4e-15 Identities = 42/62 (67%), Positives = 44/62 (70%), Gaps = 4/62 (6%) Frame = +3 Query: 510 QCGVTRGGARYPIRPIVSRITIHW----AVVLQRRDWENPGVTXLNRLAAHPPFASWRNS 677 QCG G YP P SR + + AVVLQRRDWENPGVT LNRLAAHPPFASWRNS Sbjct: 36 QCGHYLG-LNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 Query: 678 EE 683 EE Sbjct: 95 EE 96 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 79.0 bits (186), Expect = 5e-15 Identities = 37/59 (62%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = +3 Query: 513 CGVTRGGARY--PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 C ++ AR P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 76 CQTSKSNARAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 134 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 79.0 bits (186), Expect = 5e-15 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = +3 Query: 528 GGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G A P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 89 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 79.0 bits (186), Expect = 5e-15 Identities = 36/57 (63%), Positives = 39/57 (68%) Frame = +3 Query: 513 CGVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 CG P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 12 CGAITTPVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 68 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 79.0 bits (186), Expect = 5e-15 Identities = 36/56 (64%), Positives = 40/56 (71%) Frame = +3 Query: 516 GVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G +G P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 15 GKAKGTKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 78.6 bits (185), Expect = 6e-15 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = +3 Query: 507 LQCGVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 L+ G+ G P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 LEIGIMNGD---PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 63 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 78.6 bits (185), Expect = 6e-15 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +3 Query: 522 TRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 TR P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 54 TREACGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 107 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 78.6 bits (185), Expect = 6e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 516 GVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 GV + + P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 36 GVRQMASGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 91 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 78.6 bits (185), Expect = 6e-15 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +3 Query: 522 TRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 TR P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 20 TRSTVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 73 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 78.2 bits (184), Expect = 8e-15 Identities = 36/53 (67%), Positives = 39/53 (73%) Frame = +3 Query: 525 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 RG P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 53 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 78.2 bits (184), Expect = 8e-15 Identities = 37/53 (69%), Positives = 40/53 (75%) Frame = +3 Query: 525 RGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 RGG P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 84 RGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 134 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +3 Query: 537 RYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 R P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 142 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 78.2 bits (184), Expect = 8e-15 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +3 Query: 558 VSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 +SRIT AVVLQRRDWEN GVT LNRLAAHPPFASWRNSEE Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEE 129 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +3 Query: 537 RYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 R P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 105 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 78.2 bits (184), Expect = 8e-15 Identities = 36/56 (64%), Positives = 40/56 (71%) Frame = +3 Query: 516 GVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G+ A P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 87 GLIATSAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 142 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 78.2 bits (184), Expect = 8e-15 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +1 Query: 583 PSFYNVVTGKTLALPXLIALQHIPLSPAGVIAKKARTDSPXPTVAXLNGE 732 PSFYNVVTGKTLALP LIALQHIPLSPAG+ ++ARTD P + LNGE Sbjct: 87 PSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +3 Query: 537 RYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 R P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 55 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +3 Query: 537 RYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 R P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 58 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 77.8 bits (183), Expect = 1e-14 Identities = 36/56 (64%), Positives = 40/56 (71%) Frame = +3 Query: 516 GVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G R + P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 125 GKVREESGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 180 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 77.8 bits (183), Expect = 1e-14 Identities = 36/56 (64%), Positives = 39/56 (69%) Frame = +3 Query: 516 GVTRGGARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G G P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 13 GQVSGVTGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 68 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = +3 Query: 531 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 138 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = +3 Query: 531 GARYPIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 G P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 753 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 3/47 (6%) Frame = +3 Query: 552 PIVSRITIHW---AVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P++ R+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 96 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 96 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 59 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 83 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 62 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 52 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 867 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 148 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 73 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 122 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 71 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 166 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 56 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 187 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 91 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 55 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 94 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 67 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 82 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 74 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 109 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 56 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 91 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 107 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 62 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 93 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 122 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 1178 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 1224 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 682 SSLLRQLAKGGCAARRLS 629 SSLLRQLAKGGCAARRLS Sbjct: 421 SSLLRQLAKGGCAARRLS 438 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 66 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 159 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 111 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 65 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 70 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 130 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 95 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 118 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 74 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 118 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 118 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 55 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 99 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 58 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 58 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 77 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 64 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 110 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 101 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 125 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 75 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 1097 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 51 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 65 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 168 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 216 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 204 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 93 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 53 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 180 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 92 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 150 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 57 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 686 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 73 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 195 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 81 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 66 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 56 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 92 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 104 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 51 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 94 Score = 35.9 bits (79), Expect = 0.043 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = +3 Query: 636 RLAAHPPFASWRNSEE 683 +++AHPPFASWRNSEE Sbjct: 14 QVSAHPPFASWRNSEE 29 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 105 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 113 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 219 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 107 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 300 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 68 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 104 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 138 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 97 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 107 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 51 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 108 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 117 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 210 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 65 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 117 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 83 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 107 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 176 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 62 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 102 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 103 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 72 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 78 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 73 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 96 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 115 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 225 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 121 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 72 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 84 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 83 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 75 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 56 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 160 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 77 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 103 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 52 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 88 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 122 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 89 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 92 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 82 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 128 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 99 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 201 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 96 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 77.4 bits (182), Expect = 1e-14 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -1 Query: 701 GESVRA-FFAITPAGERGMCCKAIKXGNARVFPVTTL*NDGPVNCNTTHYRANW 543 G ++ A FAITPAGERGMCCK+IK +A VFP + PVNCNTTHYRANW Sbjct: 8 GRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 76 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 51 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 67 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 113 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 91 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 139 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 80 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 70 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 153 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 186 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 136 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 68 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 60 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 89 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 71 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 90 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 190 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 103 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 160 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 92 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 77 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 123 >SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 53 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 52 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 60 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 77.4 bits (182), Expect = 1e-14 Identities = 38/53 (71%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -1 Query: 701 GESVRA-FFAITPAGERGMCCKAIKXGNARVFPVTTL*NDGPVNCNTTHYRAN 546 G S+ A FAITPAGERGMCCKAIK GNAR FP PVNCNTTHYRAN Sbjct: 45 GRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 78 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 127 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 127 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 173 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 179 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 106 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 89 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 141 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 115 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 294 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 340 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 97 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 64 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 86 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 49 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 60 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 90 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 59 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 235 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 281 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 115 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 82 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 58 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 192 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 238 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 97 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 52 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 23 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 69 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 517 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 563 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 71 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 53 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 64 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 119 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 66 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 97 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 143 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 55 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 71 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 75 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 186 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 232 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 94 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 50 >SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 60 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +1 Query: 583 PSFYNVVTGKTLALPXLIALQHIPLSPAGVIAKKARTDSPXPTVAXLNGE 732 PSFYNVVTGKTLALP LIALQHIPLSPAG +++ARTD P + LNGE Sbjct: 7 PSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGE 56 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 15 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 61 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 101 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 78 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 96 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 74 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 54 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 109 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 155 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 352 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 398 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 75 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 543 PIRPIVSRITIHWAVVLQRRDWENPGVTXLNRLAAHPPFASWRNSEE 683 P+ ++ AVVLQRRDWENPGVT LNRLAAHPPFASWRNSEE Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,097,124 Number of Sequences: 59808 Number of extensions: 518334 Number of successful extensions: 9119 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9063 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -