BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0661 (848 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57289| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.037) 40 0.003 SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 37 0.018 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 37 0.024 SB_20949| Best HMM Match : TSC22 (HMM E-Value=3.5) 36 0.031 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.055 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.055 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 36 0.055 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 35 0.073 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 34 0.13 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 34 0.13 SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) 33 0.22 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 33 0.22 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_12332| Best HMM Match : PI-PLC-X (HMM E-Value=0) 33 0.29 SB_24124| Best HMM Match : DUF1213 (HMM E-Value=3.9) 33 0.39 SB_16340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_22230| Best HMM Match : CARD (HMM E-Value=3.8e-17) 32 0.51 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 32 0.68 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) 31 0.89 SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) 31 0.89 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 31 0.89 SB_4655| Best HMM Match : Spectrin (HMM E-Value=0) 31 0.89 SB_47771| Best HMM Match : Annexin (HMM E-Value=0) 31 1.2 SB_47393| Best HMM Match : Remorin_C (HMM E-Value=1.4) 31 1.2 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) 31 1.2 SB_25602| Best HMM Match : Endomucin (HMM E-Value=1.1) 31 1.6 SB_24737| Best HMM Match : KID (HMM E-Value=0.096) 31 1.6 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_14909| Best HMM Match : Spb1_C (HMM E-Value=0) 31 1.6 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 30 2.1 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 30 2.7 SB_36984| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) 30 2.7 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 30 2.7 SB_36607| Best HMM Match : Vicilin_N (HMM E-Value=3.7) 30 2.7 SB_23891| Best HMM Match : P60 (HMM E-Value=2.2) 30 2.7 SB_57708| Best HMM Match : Aldedh (HMM E-Value=0) 29 3.6 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 29 3.6 SB_52326| Best HMM Match : M (HMM E-Value=0.38) 29 3.6 SB_35430| Best HMM Match : Vicilin_N (HMM E-Value=0.43) 29 3.6 SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 29 3.6 SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) 29 3.6 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 29 3.6 SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) 29 3.6 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 29 3.6 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_14703| Best HMM Match : Borrelia_orfA (HMM E-Value=0.14) 29 3.6 SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) 29 4.8 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 29 4.8 SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) 29 4.8 SB_3881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 29 4.8 SB_9039| Best HMM Match : M (HMM E-Value=0.00046) 29 4.8 SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_53183| Best HMM Match : Ras (HMM E-Value=0) 29 6.3 SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_8393| Best HMM Match : DUF662 (HMM E-Value=3.9e-26) 29 6.3 SB_54201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 29 6.3 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_12080| Best HMM Match : p450 (HMM E-Value=0) 29 6.3 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 29 6.3 SB_59554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) 28 8.3 SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_52772| Best HMM Match : rve (HMM E-Value=0.001) 28 8.3 SB_50440| Best HMM Match : SOUL (HMM E-Value=1.7) 28 8.3 SB_50296| Best HMM Match : TP2 (HMM E-Value=9.8) 28 8.3 SB_50235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) 28 8.3 SB_45991| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.074) 28 8.3 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 28 8.3 SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) 28 8.3 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 8.3 SB_43260| Best HMM Match : Gemini_mov (HMM E-Value=0.94) 28 8.3 SB_43173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) 28 8.3 SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_40442| Best HMM Match : zf-MYM (HMM E-Value=2.7) 28 8.3 SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 28 8.3 SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) 28 8.3 SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) 28 8.3 SB_33182| Best HMM Match : rve (HMM E-Value=0.00043) 28 8.3 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 28 8.3 SB_27883| Best HMM Match : TrbF (HMM E-Value=1.5) 28 8.3 SB_23918| Best HMM Match : rve (HMM E-Value=0.013) 28 8.3 SB_20408| Best HMM Match : rve (HMM E-Value=0.0034) 28 8.3 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 28 8.3 SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) 28 8.3 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 28 8.3 SB_11351| Best HMM Match : LRV (HMM E-Value=6) 28 8.3 SB_11059| Best HMM Match : KID (HMM E-Value=0.046) 28 8.3 SB_10207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_3288| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_1077| Best HMM Match : rve (HMM E-Value=2.1e-17) 28 8.3 SB_56908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_51707| Best HMM Match : TP2 (HMM E-Value=6.3) 28 8.3 SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) 28 8.3 SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) 28 8.3 SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) 28 8.3 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 8.3 SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) 28 8.3 SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) 28 8.3 SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_24923| Best HMM Match : rve (HMM E-Value=1.5e-11) 28 8.3 SB_24601| Best HMM Match : DUF934 (HMM E-Value=1.5) 28 8.3 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 28 8.3 SB_23772| Best HMM Match : Remorin_C (HMM E-Value=1.9) 28 8.3 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 28 8.3 SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) 28 8.3 SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 28 8.3 SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) 28 8.3 SB_1527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_308| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_57289| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.037) Length = 396 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/76 (28%), Positives = 44/76 (57%), Gaps = 2/76 (2%) Frame = +1 Query: 247 RQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDI 426 + ++ Q LESA +KL ++ ++A+ ++ ++ +L E+ A +EE+T+ Sbjct: 3 KHSKELQDLESANNQKLMSEYEKYQELQAKSQKMQEDYERQLTEMEEAREQVLEELTEYY 62 Query: 427 ENKL--TTAELNREKE 468 ENKL TA+L++ +E Sbjct: 63 ENKLQEKTAQLDQSQE 78 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 37.1 bits (82), Expect = 0.018 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +2 Query: 11 KMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKM 157 KME +EKR++Y+ L++RL + VE+ R T+E+ K +E+K+ Sbjct: 208 KMEMTKEKRDSYMEALKTRLHEKSLDVEQKRQTMEEIQMFQRKILEEKL 256 Score = 33.1 bits (72), Expect = 0.29 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 5/65 (7%) Frame = +1 Query: 286 QEKLQQ--AADRRLLIE--AEQREKLRNHNIKLAEVRSAATAKVEEITKDIENK-LTTAE 450 +EKLQQ AA + ++ E + + EKL+ H ++ +S A ++E+ +K IE K + E Sbjct: 151 EEKLQQKFAASKEIIEELRSAKEEKLQAHERRVRVAQSIAQEQIEQQSKLIEEKIMQKME 210 Query: 451 LNREK 465 + +EK Sbjct: 211 MTKEK 215 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/79 (26%), Positives = 35/79 (44%) Frame = +2 Query: 8 AKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDEN 187 A E EE R A +L++ + + +EQQ+ + + I KM +KRD Sbjct: 160 ASKEIIEELRSAKEEKLQAHERRVRVAQSIAQEQIEQQSKLIEEKIMQKMEMTKEKRDSY 219 Query: 188 LKKMIERLREHEEQVRKVR 244 ++ + RL E V + R Sbjct: 220 MEALKTRLHEKSLDVEQKR 238 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 36.7 bits (81), Expect = 0.024 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = +2 Query: 53 ELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLREHEEQV 232 E R KD E EK R +QQ + K E K+ +KR++ +K ERLRE EE+ Sbjct: 908 EKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQK--ERLREKEEKE 965 Query: 233 RKVRA 247 ++ A Sbjct: 966 KQKEA 970 Score = 33.5 bits (73), Expect = 0.22 Identities = 24/85 (28%), Positives = 41/85 (48%) Frame = +1 Query: 244 RRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKD 423 R + EK ++ EK ++ +++LLIE E+REK + +L E K E K Sbjct: 917 REREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKE-RLREKEEKEKQKEAERAKK 975 Query: 424 IENKLTTAELNREKEIQKKLDFVKK 498 + +L + EKE + + D K+ Sbjct: 976 EKERLLQEDKLHEKEEKDRKDKEKR 1000 >SB_20949| Best HMM Match : TSC22 (HMM E-Value=3.5) Length = 105 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +1 Query: 310 DRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREK 465 D R+ E++ KL N+N +L E K ++TKD++ +TA+ +RE+ Sbjct: 40 DSRVKEMLERQSKLENNNKQLQEEEQLLRGKANQLTKDLQGLTSTAKKHREE 91 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 35.5 bits (78), Expect = 0.055 Identities = 25/94 (26%), Positives = 52/94 (55%), Gaps = 1/94 (1%) Frame = +1 Query: 229 SSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVE 408 S++G PE+ QQL + Q+++ A ++ ++A++ + + KLAE R K+E Sbjct: 4256 SARGNNMSPEELQQLLAQHQQEVDDAMEK---LDADRSRQQSSLQQKLAEKR---RKKLE 4309 Query: 409 EITKDIENKLTTAELNREKEIQK-KLDFVKKXER 507 + E ++T + ++KE+Q + + VK+ E+ Sbjct: 4310 AQKRKQEREMTREVMEQKKELQDIRTEHVKEAEK 4343 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 35.5 bits (78), Expect = 0.055 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 1/139 (0%) Frame = +1 Query: 94 EDQVDPGTADRGSVQGHRR*DDHSCRQARREPQEDDRASART*GTSSQGPRRQPEKFQQL 273 E + PGT S Q H D + + + +E ++ +Q + ++ ++ Sbjct: 233 EQKKTPGTKKAASKQRHPT--DEKRKDGQEKVEEKEKGEVE----DAQTTEEEEKQKEEA 286 Query: 274 ESAIQEKLQQAADRRL-LIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAE 450 E QEKL++ A ++ L E +++EKL K + R + E + I+ + + Sbjct: 287 ERKKQEKLEKLAKKKEELKERKRQEKLEQKAKKKEKERQEREKEKEREKERIQQEKEKQK 346 Query: 451 LNREKEIQKKLDFVKKXER 507 REKE QK + K+ ER Sbjct: 347 ERREKEKQKHQE-KKEKER 364 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 35.5 bits (78), Expect = 0.055 Identities = 21/77 (27%), Positives = 40/77 (51%) Frame = +2 Query: 8 AKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDEN 187 A +E ++EA EL+ L H EK + LE+ + ++++ + + +K+D Sbjct: 285 ADLEKVIAEKEAQQKELQQELSIHKSATEKLK-DLEENEKRLVTSVQE-LQSLMEKKDRE 342 Query: 188 LKKMIERLREHEEQVRK 238 L K +E ++ EE+ RK Sbjct: 343 LLKQMEVTKKAEEEARK 359 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 35.1 bits (77), Expect = 0.073 Identities = 17/78 (21%), Positives = 43/78 (55%) Frame = +2 Query: 11 KMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENL 190 +M T +EK + + ++L+D L K++ Q+ +E Y+A++++M + + Sbjct: 431 RMATEQEKESKSLRKKNNQLEDELTNQGKSKEQEAQEHSEKYEALKNEMQQQGKEWLKQD 490 Query: 191 KKMIERLREHEEQVRKVR 244 K+ +++ E E++ + +R Sbjct: 491 KESHKQIEEREKECKSLR 508 Score = 28.7 bits (61), Expect = 6.3 Identities = 19/81 (23%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = +2 Query: 5 DAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAAD---K 175 + + + H EK EA NE++ + K+ L+ +++ +E++ E K++ D++ D K Sbjct: 462 EQEAQEHSEKYEALKNEMQQQGKEWLKQDKESHKQIEEREKEC-KSLRDEVRKLRDNLSK 520 Query: 176 RDENLKKMIERLREHEEQVRK 238 +D + + + E +RK Sbjct: 521 QDLSRNDEVAGFLKERELLRK 541 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 35.1 bits (77), Expect = 0.073 Identities = 30/127 (23%), Positives = 57/127 (44%) Frame = +1 Query: 124 RGSVQGHRR*DDHSCRQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQ 303 R S HRR D+ R+ ++ + + R RR+ E ++ E + + + Sbjct: 1134 RRSDSWHRRDDEERMRREEKDARRREEEERRL-REEEDRLRREDELRRKREDDDRGRRKL 1192 Query: 304 AADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKKL 483 A +RRLL E +RE R + R + E+ + E + +AEL +E+++K Sbjct: 1193 AEERRLLEEERRREDERRR--EEDRKRLEDLKRFEDEKRRAEEEKKSAELRIAEEVRRKA 1250 Query: 484 DFVKKXE 504 + ++ E Sbjct: 1251 EQARRQE 1257 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/76 (26%), Positives = 40/76 (52%) Frame = +2 Query: 17 ETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKK 196 E E+++E N++ K E +E R EQ E + +E++ ++ DE + Sbjct: 1196 EMREKEKEMEQNKIDQE-KRKQELMESRRFQEEQDRLEEERRLEEERLRQLEEEDEQRRL 1254 Query: 197 MIERLREHEEQVRKVR 244 E++RE EE++R+++ Sbjct: 1255 EEEQIREAEEELRRLQ 1270 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 34.3 bits (75), Expect = 0.13 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 13/118 (11%) Frame = +1 Query: 169 RQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLL-------- 324 RQ R QE+ R + ++ + EK + E + KLQ+ ++R L Sbjct: 243 RQEERRRQEEKRRAEEEAKRKAEEEKAAREKAEMEEKLRRLKLQEKEEKRKLEAEKKEKE 302 Query: 325 -IEAEQREKLRNHNIK-LAEVRSAATAKVEEITK---DIENKLTTAELNREKEIQKKL 483 +E EQRE+ R K AE ++ A+ E K ++E ++ E RE E Q+ L Sbjct: 303 RVEREQREERRKQEEKRRAEEQARRKAEEERAAKAKAEMEERMRKLEEKREAERQEAL 360 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/73 (21%), Positives = 40/73 (54%) Frame = +2 Query: 26 EEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIE 205 +E+R A +E+ +R ++ L +++ R ++ E+ A E+K ++R+ ++ + Sbjct: 462 DERRRAEEDEI-ARQEEELRRLQEQREKELKRYKELQMAEEEKRRKETEERERQAREEED 520 Query: 206 RLREHEEQVRKVR 244 R+R E+ ++R Sbjct: 521 RIRREREEAERLR 533 Score = 29.5 bits (63), Expect = 3.6 Identities = 25/99 (25%), Positives = 45/99 (45%) Frame = +1 Query: 172 QARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKL 351 + R+E + ++ A + RRQ EK + E A ++ ++ A R +AE EKL Sbjct: 224 EERKEQERKEKELAELEKKRQEERRRQEEKRRAEEEAKRKAEEEKAARE---KAEMEEKL 280 Query: 352 RNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKE 468 R +KL E + E+ K+ + E +++E Sbjct: 281 R--RLKLQEKEEKRKLEAEKKEKERVEREQREERRKQEE 317 Score = 29.5 bits (63), Expect = 3.6 Identities = 28/116 (24%), Positives = 56/116 (48%), Gaps = 6/116 (5%) Frame = +1 Query: 175 ARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAE------ 336 AR + E RA A+ + RR+ E+ Q+ E +EK Q+ + RL +EAE Sbjct: 379 ARLQEAERRRAEAKE-RERQEEERRKGEERQRQE---EEKRQKEEEERLRVEAERQREED 434 Query: 337 QREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKKLDFVKKXE 504 +R++ + + + R +++ + KD + E+ R++E ++L ++ E Sbjct: 435 ERQRAEDERQRAEDERQRVKHEMQRL-KDERRRAEEDEIARQEEELRRLQEQREKE 489 >SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) Length = 909 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Frame = +1 Query: 256 EKFQQLESAIQE---KLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDI 426 EKF +L++ + + +L++ +R+ ++ R K + A +++E + KD+ Sbjct: 550 EKFAELQTRLAKSAKELEEELERKREDYNTAADERRYQMAKKKDTLQATRSELETLVKDL 609 Query: 427 ENKLTTAELNREKEIQKK 480 K L EKEIQKK Sbjct: 610 STKTGKERLALEKEIQKK 627 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +2 Query: 26 EEKREAYINELRSRLKDHLEG-VEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMI 202 E++RE + E ++ +D +E +EK R L + AE+ + +E ++ D + ++ + Sbjct: 97 EQEREVFAKE-KAEFQDQIENQIEKEREILAKARAEIQEQMEGQIGQERDILAKEKEEFM 155 Query: 203 ERLREHEEQVRKV 241 ER+ E E R++ Sbjct: 156 ERMYEELESERQI 168 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.1 bits (72), Expect = 0.29 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 2/94 (2%) Frame = +1 Query: 4 RRQDGDPRGKTRGLHQRAALPSQGSS*GR*EDQVDPGTADRGSVQGHR--R*DDHSCRQA 177 R+ D PRG RG + P + S R +D P DR + R R DD + R+ Sbjct: 297 RKDDRQPRGDDRGQMKDDREPMKDDSKLR-KDNKGPRKDDREPRRDDREPRRDDRATRKD 355 Query: 178 RREPQEDDRASART*GTSSQGPRRQPEKFQQLES 279 R+P+ DDR + + P + K ++ ES Sbjct: 356 DRQPRGDDRGQMK----DDREPMKDDSKLRKDES 385 Score = 32.3 bits (70), Expect = 0.51 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = +1 Query: 4 RRQDGDPRGKTRGLHQRAALPSQGSS*GR*EDQVDPGTAD---RGSVQGHRR*DDHSCRQ 174 R+ D +PR R + P +G G+ +D +P D R +G R+ DD R+ Sbjct: 283 RKVDREPRRDDRATRKDDRQP-RGDDRGQMKDDREPMKDDSKLRKDNKGPRK-DDREPRR 340 Query: 175 ARREPQEDDRASAR 216 REP+ DDRA+ + Sbjct: 341 DDREPRRDDRATRK 354 >SB_12332| Best HMM Match : PI-PLC-X (HMM E-Value=0) Length = 1038 Score = 33.1 bits (72), Expect = 0.29 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 1/87 (1%) Frame = +1 Query: 253 PEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEV-RSAATAKVEEITKDIE 429 P FQ E Q++L D E E+ E + + E+ +S + +K++ I ++ E Sbjct: 618 PIAFQSQEDKRQQQLAALLDEEDEPENEESEVFEDGFV--GEIAKSPSASKLQSIPQEKE 675 Query: 430 NKLTTAELNREKEIQKKLDFVKKXERP 510 NK +++EKE KK +KK P Sbjct: 676 NKKRQQSISQEKE-GKKRQSIKKSSEP 701 >SB_24124| Best HMM Match : DUF1213 (HMM E-Value=3.9) Length = 283 Score = 32.7 bits (71), Expect = 0.39 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 3/107 (2%) Frame = +1 Query: 169 RQARREPQEDDRASART*GTSSQGPRRQPEKF---QQLESAIQEKLQQAADRRLLIEAEQ 339 RQA R+PQ+ AS +T + G + K Q S Q++ +QAA R+ +Q Sbjct: 175 RQASRKPQDKQAASPKTSKPQAPGKASRKTKTSNPQTKTSKPQDQDKQAARRKTSKLQDQ 234 Query: 340 REKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKK 480 ++ H KL + ++ A+ + ++ +++K ++ + KK Sbjct: 235 DKQAARHTSKLQDKQA---ARPRQASRKLQDKQVASQARPRQASHKK 278 >SB_16340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 32.7 bits (71), Expect = 0.39 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 3/63 (4%) Frame = +2 Query: 62 SRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKR---DENLKKMIERLREHEEQV 232 SRLK+ L+ E LE + +E+ A E +TTA +++ ++ + ++R +E EEQV Sbjct: 117 SRLKEQLQKSESWVAKLETELSELRLAGEKNITTAMEQQKRLKDSYDETVKRNQELEEQV 176 Query: 233 RKV 241 K+ Sbjct: 177 LKM 179 Score = 32.3 bits (70), Expect = 0.51 Identities = 22/71 (30%), Positives = 35/71 (49%) Frame = +2 Query: 29 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIER 208 EK E + RLKD + K LE+Q ++ D+M ++ +E LK + ER Sbjct: 145 EKNITTAMEQQKRLKDSYDETVKRNQELEEQVLKM----ADEMQEERERFEEALKVVTER 200 Query: 209 LREHEEQVRKV 241 L E E++ K+ Sbjct: 201 LVETREKMNKM 211 >SB_22230| Best HMM Match : CARD (HMM E-Value=3.8e-17) Length = 555 Score = 32.3 bits (70), Expect = 0.51 Identities = 26/85 (30%), Positives = 42/85 (49%) Frame = +1 Query: 241 PRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITK 420 PRR P F A++ +Q+ LL E E+ EKL +L R+ + EEIT Sbjct: 82 PRRGPNAFDAFVEALKN-VQEFLVGPLLQEVEREEKLAEMKNELTRARTHSARLREEIT- 139 Query: 421 DIENKLTTAELNREKEIQKKLDFVK 495 I L +E ++ + +K+L+ +K Sbjct: 140 SIGTHL-DSEKHKHEHTKKELEELK 163 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 31.9 bits (69), Expect = 0.68 Identities = 20/79 (25%), Positives = 40/79 (50%) Frame = +1 Query: 232 SQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEE 411 +Q +R E QQ ES ++ + RL E +E L H ++ E+R++ K++E Sbjct: 1094 TQAEKRLEELIQQHESEMEGVDSRIQQARLESENNFKEILETHQREMEEIRNSHENKMQE 1153 Query: 412 ITKDIENKLTTAELNREKE 468 + ++ ++L + EK+ Sbjct: 1154 MAENHASELAQMKDIYEKQ 1172 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +1 Query: 268 QLESAIQEKLQQAADRRLLIEAE-QREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTT 444 Q E ++E +QQ +++ Q+ +L + N E+ ++EEI ENK+ Sbjct: 1095 QAEKRLEELIQQHESEMEGVDSRIQQARLESEN-NFKEILETHQREMEEIRNSHENKMQE 1153 Query: 445 AELNREKEIQKKLDFVKKXER 507 N E+ + D +K R Sbjct: 1154 MAENHASELAQMKDIYEKQNR 1174 Score = 29.1 bits (62), Expect = 4.8 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Frame = +1 Query: 259 KFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDI---E 429 K +Q + ++E +QQ +R +EK +H LA+++ A K+ E+T+ I E Sbjct: 360 KNEQEQEKMKELIQQHNNRL-------KEKQEDHQKNLAKLKKAHQNKITELTETIKKAE 412 Query: 430 NKLTTAELNREKEIQK 477 +K +E R+ E +K Sbjct: 413 HKAVESEKQRKLENEK 428 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 31.9 bits (69), Expect = 0.68 Identities = 18/77 (23%), Positives = 44/77 (57%), Gaps = 5/77 (6%) Frame = +2 Query: 17 ETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEV---YKAIEDKMTTAADKR--D 181 E + + E ++EL + E VEK +++ +++ YKA+E+K + +++ + Sbjct: 944 ENSKLETERQLSELSKETCHYKEKVEKQNQEIQELQSKINLLYKAVEEKDSEINNQKIEN 1003 Query: 182 ENLKKMIERLREHEEQV 232 +NL K+++ +RE+ + + Sbjct: 1004 DNLGKVVDSMRENLQSI 1020 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 31.9 bits (69), Expect = 0.68 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +2 Query: 23 HEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAAD-KRDENLKKM 199 +E +++A I + R +L +E RL+ E + A + K + M A + KR ENL KM Sbjct: 328 YEYEQKAKIEKERDKLV-----IEVERLSDEMKKAGLPKEVLSLMNDAREEKRSENLSKM 382 Query: 200 IERLREHEEQVR 235 ++L E +E+++ Sbjct: 383 EKKLSETQEKLQ 394 >SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) Length = 440 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/59 (23%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = +2 Query: 47 INELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDE--NLKKMIERLRE 217 +N+ +L + +EG++ T +TL+QQ ++ + + + TT+ + R + ++K + +E Sbjct: 251 LNDFVIQLDEEVEGMQSTIMTLQQQIKDIKQRLATETTTSQELRTKCHQVEKCLSEAKE 309 >SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) Length = 359 Score = 31.5 bits (68), Expect = 0.89 Identities = 21/100 (21%), Positives = 51/100 (51%), Gaps = 2/100 (2%) Frame = +1 Query: 181 REPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 360 ++ E++R + RR+ E+ ++ + ++++ ++ +RRL++E ++RE R Sbjct: 252 QKENEEERLRKEKEERKMEEERRRDEQARR-DRELEDQQRKDEERRLIMEQQERE--RRQ 308 Query: 361 NIKLAEVRSAATAKVEEITKDIENKL--TTAELNREKEIQ 474 ++ + +VEE K +E + L REK+++ Sbjct: 309 EMEYLQREKEERLRVEEALKKLEREKEEERQRLEREKDLE 348 Score = 29.1 bits (62), Expect = 4.8 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +2 Query: 5 DAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADK-RD 181 + KME EE+R L+D E+ RL +EQQ E + +E ++ R Sbjct: 266 ERKME--EERRRDEQARRDRELEDQQRKDEERRLIMEQQERERRQEMEYLQREKEERLRV 323 Query: 182 ENLKKMIERLREHEEQ 229 E K +ER +E E Q Sbjct: 324 EEALKKLEREKEEERQ 339 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 31.5 bits (68), Expect = 0.89 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 4/81 (4%) Frame = +2 Query: 11 KMETHEEKREAYINELRSRLKDHLEGVEKTRLT---LEQQTAEVYKAIED-KMTTAADKR 178 +ME+ +EK E+ + ELR++L D LE + L +++ A + +E+ K A + Sbjct: 118 EMESEQEKHESELEELRAQL-DKLENSDTESLVEERMKELKANYEREVEELKERLAKGES 176 Query: 179 DENLKKMIERLREHEEQVRKV 241 D ++ ER++E ++ K+ Sbjct: 177 DARDSELTERIQEIDDLKSKM 197 >SB_4655| Best HMM Match : Spectrin (HMM E-Value=0) Length = 934 Score = 31.5 bits (68), Expect = 0.89 Identities = 22/73 (30%), Positives = 38/73 (52%) Frame = +1 Query: 268 QLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTA 447 ++E I EKLQ A+D ++KL+ H AE+ SA + + E+T E + + Sbjct: 59 EVEDWINEKLQIASDESYRDPMNLQDKLQKHQAFEAEI-SAHSYAITELTDTGEEMINES 117 Query: 448 ELNREKEIQKKLD 486 E +I+++LD Sbjct: 118 HYASE-DIRERLD 129 >SB_47771| Best HMM Match : Annexin (HMM E-Value=0) Length = 529 Score = 31.1 bits (67), Expect = 1.2 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 2/86 (2%) Frame = +1 Query: 253 PEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHN-IKLAE-VRSAATAKVEEITKDI 426 P+ + ++E E L++ RL +E + +N ++ AE ++ +TA E K+ Sbjct: 209 PKAYFEVEKRCSEDLKKIILNRLKDRSEDEKPAKNETPLREAEDIKETSTAAQPE--KND 266 Query: 427 ENKLTTAELNREKEIQKKLDFVKKXE 504 ENK + ++EK+ + KLD V+K E Sbjct: 267 ENKDIEDDKDKEKKSRPKLD-VRKIE 291 >SB_47393| Best HMM Match : Remorin_C (HMM E-Value=1.4) Length = 396 Score = 31.1 bits (67), Expect = 1.2 Identities = 33/122 (27%), Positives = 60/122 (49%), Gaps = 12/122 (9%) Frame = +1 Query: 178 RREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQ-------EKLQQAADRR--LLIE 330 R+ ++ +ASAR+ SS R+ + +L A++ EK +AA+ R L + Sbjct: 223 RQLEKKKKKASARS--RSSDASDRRASRSNKLREALEMADKLAKEKSARAAENRDKHLAD 280 Query: 331 AEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNRE---KEIQKKLDFVKKX 501 + + + + V S A AKVE ++IE K E+N++ KE ++KL ++ Sbjct: 281 VKSKASRLAGSSQQQVVESEACAKVELRQREIERKGKMVEMNKDKAAKEAREKLRLRRER 340 Query: 502 ER 507 E+ Sbjct: 341 EQ 342 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 31.1 bits (67), Expect = 1.2 Identities = 27/127 (21%), Positives = 60/127 (47%), Gaps = 2/127 (1%) Frame = +1 Query: 133 VQGHRR*DDHSCRQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAAD 312 ++ RR D+ + R E Q+ R + RRQ ++ Q E + ++++A Sbjct: 1455 MEEERRRDEQARRDKELEDQKRKDEERRLIMEQQERERRQEMEYLQREKEERLRVEEALK 1514 Query: 313 RRLLIEAEQREKL-RNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQ-KKLD 486 + + E+R++L R +++ +V + ++ + + E + EK IQ +K++ Sbjct: 1515 KLEREKEEERQRLEREKELEIERQLKIKEKEVIRLQRERDEERRRRE-DEEKRIQMEKVE 1573 Query: 487 FVKKXER 507 +K+ ER Sbjct: 1574 ELKRIER 1580 Score = 29.5 bits (63), Expect = 3.6 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +2 Query: 5 DAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADK-RD 181 + KME EE+R L+D E+ RL +EQQ E + +E ++ R Sbjct: 1452 ERKME--EERRRDEQARRDKELEDQKRKDEERRLIMEQQERERRQEMEYLQREKEERLRV 1509 Query: 182 ENLKKMIERLREHEEQ 229 E K +ER +E E Q Sbjct: 1510 EEALKKLEREKEEERQ 1525 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 228 KFARSAPATGEVPAARERHPGEAAAGRR 311 K A T E PA R +HPG AGRR Sbjct: 1059 KTAHEPARTPEPPATRPKHPGRVEAGRR 1086 >SB_16617| Best HMM Match : Vicilin_N (HMM E-Value=5.5) Length = 547 Score = 31.1 bits (67), Expect = 1.2 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 1/105 (0%) Frame = +1 Query: 169 RQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEK-LQQAADRRLLIEAEQRE 345 RQA R+PQ+ AS +T + Q PR+ K + + Q+K + A R+ + Sbjct: 237 RQASRKPQDKQAASPKT--SKPQAPRQASRKTKTSKLQDQDKQAARQASRKTSKTKTKTS 294 Query: 346 KLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKK 480 K ++ + + A R A T + K + + + R ++ +K Sbjct: 295 KPQDQDKQAARPRQARTRQASRKKKTRKPQEQAKQAARPRQASRK 339 >SB_25602| Best HMM Match : Endomucin (HMM E-Value=1.1) Length = 393 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +2 Query: 38 EAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLRE 217 E I LRS + + V K +L + +K I++K+T+AA E + K++ L E Sbjct: 196 ECKIEMLRSEVSASINDVAKKISSLTSKVTSEFKLIKNKLTSAA----ETILKVLGELGE 251 Query: 218 HEEQV 232 +EQ+ Sbjct: 252 IKEQL 256 >SB_24737| Best HMM Match : KID (HMM E-Value=0.096) Length = 636 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/71 (26%), Positives = 37/71 (52%) Frame = +2 Query: 29 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIER 208 E RE I++L LKD + + TLEQ A++ K + ++ A+K + + ++ + Sbjct: 148 EDREKSIDKLEKELKDQEAKHNRQKNTLEQTVAKM-KEVMERKGGDANKVNARVAELEKE 206 Query: 209 LREHEEQVRKV 241 L+E + K+ Sbjct: 207 LKEKTKSAEKL 217 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 15 WRPTRKNARPTSTSCAPVSRIILRALRRPG*PWNS 119 W RK ARP S SC+P ++ L RP W+S Sbjct: 7 WEQRRKPARPRSNSCSPGDPLV---LERPPPRWSS 38 >SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/76 (22%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +2 Query: 23 HEEKREAYINE-LRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKM 199 H A + E L+ + H E +E+ L+QQ + + I+ ++ K++ +K+ Sbjct: 149 HYSSENAKLEEALKRACEKHAEHMEQLDDELDQQMSRLEMRIKKELENKIKKKEPEEQKL 208 Query: 200 IERLREHEEQVRKVRA 247 E + E +++R +R+ Sbjct: 209 KEEIEEKVQELRYLRS 224 >SB_14909| Best HMM Match : Spb1_C (HMM E-Value=0) Length = 437 Score = 30.7 bits (66), Expect = 1.6 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +1 Query: 289 EKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKE 468 +K+ +A R+ E ++ E+ R K V A +E K I+N A +N++KE Sbjct: 328 KKIAEAKGRKKRKELKRVERARK---KAEAVCDAPDVTAQEKMKQIQNLYKKASINKKKE 384 Query: 469 IQ----KKLDFVKKXERP 510 I+ KK K+ +RP Sbjct: 385 IKYVVTKKHQSAKRMKRP 402 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%) Frame = +1 Query: 244 RRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAK---VEEI 414 R + EK + + +++K Q ++ + ++ AEQ E R + E+R K +EE+ Sbjct: 896 REKLEKLETEYTDLEKKHSQISEEKAIV-AEQLESEREVAQETEEMRQRLQTKKNELEEL 954 Query: 415 TKDIENKLTTAELN 456 D+E ++T E N Sbjct: 955 LSDLEGRITEEEEN 968 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 30.3 bits (65), Expect = 2.1 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%) Frame = +1 Query: 244 RRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKD 423 +R E +Q++ +E+++ D+ +E E+ + NH + S K E T Sbjct: 229 KRMGEDEEQIKLK-EEEVEIKEDKTAELELEETTEKSNHAKRENLSPSKIHKKDREKTPT 287 Query: 424 IENKLTTAELNREKEIQK--KLDFVKKXER 507 +NK + N EK++QK + D KK E+ Sbjct: 288 KKNKEKNVKKNEEKDVQKEEEKDVQKKVEK 317 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 30.3 bits (65), Expect = 2.1 Identities = 35/164 (21%), Positives = 67/164 (40%), Gaps = 5/164 (3%) Frame = +1 Query: 4 RRQDGDPRGKTRGLHQRAALPSQGSS*GR*EDQVDPGTADRGS-----VQGHRR*DDHSC 168 RR + D G+ RG +R S+ R E++ + ADR + RR D+ Sbjct: 1010 RRDEEDTIGRVRGRRERGESRSREEI-MREEEERERREADRRREEERIAEQKRRDDEERL 1068 Query: 169 RQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREK 348 R+ E + ++ + R + E+ ++ E + E+ + +RR E EQR + Sbjct: 1069 RREEEERRLEEERRREEERKREEVRRLEEERKREEERRLAEQRRVEEERRRKEEEEQRRR 1128 Query: 349 LRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKK 480 + E + E ++ E +L RE+E +++ Sbjct: 1129 EEEERRRREE---EDRLREEARRREEERRLEDERWEREREEERR 1169 >SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 246 PATGEVPAARERHPGEAAAGRR 311 P + E PA R +HPG AGRR Sbjct: 167 PRSPEPPATRPKHPGRVEAGRR 188 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/82 (25%), Positives = 46/82 (56%), Gaps = 3/82 (3%) Frame = +2 Query: 2 VDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIED---KMTTAAD 172 V +M E+K + ++ E ++ L++ L ++KT+ L Q+ E+++A E+ M Sbjct: 2865 VKKEMVATEKKVKLFL-EKQNLLEEKLLLLQKTKEELRQKETELHEAREEITVLMNRIES 2923 Query: 173 KRDENLKKMIERLREHEEQVRK 238 +D+ +KK+++ + E E V + Sbjct: 2924 SKDKQIKKVMKAVCEDIEAVEE 2945 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/52 (36%), Positives = 31/52 (59%) Frame = +1 Query: 265 QQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITK 420 ++LES + EKLQ AA+ ++KL+ H AEV SA ++++ IT+ Sbjct: 1803 KELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEV-SAHKSELDAITQ 1853 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 29.9 bits (64), Expect = 2.7 Identities = 22/112 (19%), Positives = 49/112 (43%) Frame = +1 Query: 172 QARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKL 351 + R+ E +R A Q + + E+ +Q E +Q + ++ RR + QR++ Sbjct: 576 EKERKTLEKERREAEA-RALQQKQQEEEERRRQQELLLQRQREEEEMRRQQEQMLQRQRE 634 Query: 352 RNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKKLDFVKKXER 507 + E + EE+ K E + EL + ++ Q++ ++K ++ Sbjct: 635 EEERRRQQEEAERQRREQEEVFKQQEQQRQQLELQKRQQEQQRQQELQKRQQ 686 >SB_36984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/58 (27%), Positives = 35/58 (60%) Frame = +2 Query: 59 RSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLREHEEQV 232 R + + H EG E+ R EQ+ + K DKM +++++ L++ ++R+R+ +E++ Sbjct: 396 RPQSQTHKEG-ERDR---EQEGGDEMKDALDKMAIKLERQNQELQEAMQRVRQQDEKL 449 >SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) Length = 770 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PAAR +HPG AGRR Sbjct: 225 EPPAARPKHPGRVEAGRR 242 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/58 (27%), Positives = 35/58 (60%) Frame = +2 Query: 59 RSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLREHEEQV 232 R + + H EG E+ R EQ+ + K DKM +++++ L++ ++R+R+ +E++ Sbjct: 88 RPQSQTHKEG-ERDR---EQEGGDEMKDALDKMAIKLERQNQELQEAMQRVRQQDEKL 141 >SB_36607| Best HMM Match : Vicilin_N (HMM E-Value=3.7) Length = 567 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/64 (28%), Positives = 35/64 (54%) Frame = +1 Query: 163 SCRQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQR 342 S + +P++ D+ +AR TSS+ + ++ +Q E QE+ +QAA +R ++ R Sbjct: 421 SLKTKASKPEDQDKQAARPRQTSSKTKTSKNKRSKQQEKDKQEQDKQAARKRQARTSQAR 480 Query: 343 EKLR 354 K + Sbjct: 481 CKTK 484 Score = 29.1 bits (62), Expect = 4.8 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 5/86 (5%) Frame = +1 Query: 169 RQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQA-----ADRRLLIEA 333 RQA R+PQ+ AS +T + RQP + + S Q++ +QA A R+ Sbjct: 132 RQASRKPQDKQAASRKTSKPQDKQAARQPSR-KTKTSKPQDQDKQAERPRQASRKKKTSK 190 Query: 334 EQREKLRNHNIKLAEVRSAATAKVEE 411 + K+++ + + A S T+K ++ Sbjct: 191 NKPSKMQDQDKQAARQASRKTSKPQD 216 >SB_23891| Best HMM Match : P60 (HMM E-Value=2.2) Length = 1167 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/82 (21%), Positives = 43/82 (52%) Frame = +2 Query: 2 VDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRD 181 V+ + + + E I ++ +D +EGV K + +E+Q EV + E+ + + Sbjct: 218 VEVQKDAKASEEETAIVDVEGVEEDKVEGVAKVQDEVEEQ-KEVKASEEETAVVDVEGVE 276 Query: 182 ENLKKMIERLREHEEQVRKVRA 247 E+ + +E++++ +Q +V+A Sbjct: 277 EDKVEGVEKVQDEVKQKEEVKA 298 >SB_57708| Best HMM Match : Aldedh (HMM E-Value=0) Length = 528 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +2 Query: 113 EQQTAEVYKAIEDKMTTAADKRDENLKKMIERLREHEEQVRKV 241 E E YKA + T A +R E L+K + + +H+ ++ ++ Sbjct: 101 ELAVQEAYKAFQTWKKTTAKERSEKLRKWFQLILQHQNELAEL 143 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 29.5 bits (63), Expect = 3.6 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 8/81 (9%) Frame = +2 Query: 14 METHEEKREAYINELRSRLKDH--LEGV-EKTRL---TLEQQTAEVYKAIEDKMTTAADK 175 ++ + K EL+S +K L+GV E+T+L L+++ ++ K + ++ D+ Sbjct: 2117 LQDSQNKLGGLEEELQSEMKQQAQLKGVLEQTKLRNDNLKEEILKLQKKLAEQQKYHEDQ 2176 Query: 176 -RD-ENLKKMIERLREHEEQV 232 RD LK +IERLRE E + Sbjct: 2177 IRDFPELKAVIERLREENENL 2197 >SB_52326| Best HMM Match : M (HMM E-Value=0.38) Length = 237 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +1 Query: 265 QQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIE 429 Q+ IQE + Q + + EQ EKL N +L E + +++E + KD++ Sbjct: 185 QEQHDEIQEMILQKSRENFV--GEQLEKLFYENTRLKEQKKILQSRIESLEKDLK 237 >SB_35430| Best HMM Match : Vicilin_N (HMM E-Value=0.43) Length = 238 Score = 29.5 bits (63), Expect = 3.6 Identities = 30/127 (23%), Positives = 61/127 (48%), Gaps = 9/127 (7%) Frame = +1 Query: 163 SCRQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQR 342 S RQ + + D + RT T + + Q+LES + K+Q + + +Q+ Sbjct: 80 SMRQEVEKAKSDLEETKRTLETYESRANNELNEKQKLESEYKRKMQVMEAKIATLRRKQK 139 Query: 343 --EKL-RNHNIKLAEVRSAAT------AKVEEITKDIENKLTTAELNREKEIQKKLDFVK 495 EK+ H+ + +V+ T A+ +++TK + + + + E+++QK+L VK Sbjct: 140 DSEKVSAMHDEREKKVQDLMTQMERMRAQQDQLTKRLREE-SDRKARLERDMQKQLQRVK 198 Query: 496 KXERPPS 516 + E+ S Sbjct: 199 ELEQQTS 205 >SB_29610| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 1353 Score = 29.5 bits (63), Expect = 3.6 Identities = 30/116 (25%), Positives = 52/116 (44%) Frame = +1 Query: 163 SCRQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKLQQAADRRLLIEAEQR 342 SC+ +PQ+ D+ S R G S+ R + K Q ++A Q + +QA+ ++ Sbjct: 897 SCKTMASKPQDQDKQSTRP-GQKSRKTRTK--KPQDKQAARQSRPRQAS---------RK 944 Query: 343 EKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKKLDFVKKXERP 510 K R + +V A A + T ++N+ A R+K + K+ ERP Sbjct: 945 SKARARQDQGKQVARARQASRKIKTSKLQNQNKQAARPRQKSRKTSKPHHKQAERP 1000 >SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1535 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/65 (30%), Positives = 35/65 (53%) Frame = +1 Query: 244 RRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKD 423 RR+ K Q ++ + EKL + +R + I+ + R+K + K ++R + E +D Sbjct: 954 RRKFAKTQARKNKVVEKLSKRLNR-VKIKNKFRKKTKQSARKSRKIRLKWKEEQERFWQD 1012 Query: 424 IENKL 438 IENKL Sbjct: 1013 IENKL 1017 >SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1805 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/61 (24%), Positives = 34/61 (55%) Frame = +2 Query: 20 THEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKM 199 T E EA +++L + EG+ +++++L++ +E++ +EDK +R + L M Sbjct: 456 TKERLHEA-VSDLLELTRGETEGLRESQISLDENWSELWALLEDKEEELLRRRGDLLVVM 514 Query: 200 I 202 + Sbjct: 515 L 515 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/66 (22%), Positives = 38/66 (57%) Frame = +1 Query: 289 EKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKE 468 EK++Q+ + ++ + ++EKL+ N +L R E++ +++E E+NR ++ Sbjct: 526 EKMRQSLNEQVEGLSAEKEKLQAANNELQRQRDNLEDDKEDLQREVER--MAKEINRSQQ 583 Query: 469 IQKKLD 486 + ++L+ Sbjct: 584 VTEQLE 589 >SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) Length = 1426 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/61 (24%), Positives = 36/61 (59%) Frame = +2 Query: 65 RLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLREHEEQVRKVR 244 ++KD ++ +E+ TL++QTA+ +++ + + + E +K + +E EE ++ +R Sbjct: 375 KVKDDIDDIEENLQTLKKQTADEQQSLANLLEEEEAIKLEKQQKYRDWRKEIEELLQALR 434 Query: 245 A 247 A Sbjct: 435 A 435 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 29.5 bits (63), Expect = 3.6 Identities = 24/88 (27%), Positives = 40/88 (45%) Frame = +1 Query: 244 RRQPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKD 423 RR+ ++ +Q+ ++EK + E E++EK R K EV + E I Sbjct: 133 RRRAKEMEQIAMELEEKRK---------EEEEKEKQR----KQLEVEKQKRLEEERIRSQ 179 Query: 424 IENKLTTAELNREKEIQKKLDFVKKXER 507 E + +E+E Q+KLD K+ R Sbjct: 180 NEERKRREREQKEREKQQKLDMEKEERR 207 >SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/76 (22%), Positives = 37/76 (48%) Frame = +2 Query: 11 KMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENL 190 K++ + +K++ + +L++ L D E + TL+ E+ + +DK T + + ENL Sbjct: 454 KLDAYAKKQQEELVKLKAELDDANEKNRSLQTTLDNAYKELTELHKDKATRESTTKIENL 513 Query: 191 KKMIERLREHEEQVRK 238 + E+V + Sbjct: 514 QSTHSNQASSWEKVER 529 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/64 (31%), Positives = 34/64 (53%) Frame = +1 Query: 256 EKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENK 435 E QQLE +EK ++ + E+R+KL N K A A A+++ + +++E K Sbjct: 503 ETKQQLEELEKEKSEKLTKEQEEALEEERKKLTEANEKFAADLEAKDAELKALKEELE-K 561 Query: 436 LTTA 447 L T+ Sbjct: 562 LQTS 565 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 29.5 bits (63), Expect = 3.6 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +2 Query: 2 VDAKMETHEEKREAYINELRSRLKDHLE---GVEKTRLTLEQQTAEVYKAIEDKMTTAAD 172 ++AKM EE+++ + NEL + L +E R + Q E+ + I+D + + Sbjct: 2529 MEAKMSDLEEEKQKFTNELYLSTRKVLSLQLNLESLRNEVSQLGKELRRLIQDSL--GRE 2586 Query: 173 KRDENLKKMIE 205 RDE +K IE Sbjct: 2587 PRDEAEEKSIE 2597 >SB_14703| Best HMM Match : Borrelia_orfA (HMM E-Value=0.14) Length = 558 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/72 (26%), Positives = 36/72 (50%) Frame = +2 Query: 29 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIER 208 E R I++L LKD + + TLEQ A++ K + ++ A+K + + ++ + Sbjct: 208 EDRGKSIDKLEKELKDQEAKHNRQKNTLEQTVAKM-KEVMERKGGDANKVNARVAELEKE 266 Query: 209 LREHEEQVRKVR 244 L+E + K R Sbjct: 267 LKEKTKSAEKAR 278 >SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) Length = 311 Score = 29.1 bits (62), Expect = 4.8 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 4/83 (4%) Frame = +2 Query: 11 KMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT----AEVYKAIEDKMTTAADKR 178 K + E+R A I + ++ LE V+ L QQ AE+ K + K D++ Sbjct: 76 KAKKQMEQRMAEIGVEKGNVERSLEEVQSQNKDLMQQAERAKAELAK-LSAKYEELEDEK 134 Query: 179 DENLKKMIERLREHEEQVRKVRA 247 DE + + + +RE ++R + A Sbjct: 135 DEMQESLSDTIREKSREIRDLEA 157 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/76 (21%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +2 Query: 5 DAKMETHEEKREAYINELRSRLKDHL-EGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRD 181 + K E EE+++ E + ++++ + V+K + EQ+ + E K +++ Sbjct: 46 EQKQEVQEEQKQEVQEEQKQKVQEEQKQEVQKEQKQEEQEEQKQEVQEEQKQEEQEEQKQ 105 Query: 182 ENLKKMIERLREHEEQ 229 E K+ ++ ++ EEQ Sbjct: 106 EEQKQEVQEEQKQEEQ 121 >SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 29.1 bits (62), Expect = 4.8 Identities = 19/76 (25%), Positives = 43/76 (56%), Gaps = 2/76 (2%) Frame = +2 Query: 8 AKMETHEEKREAYINELRSRLKDHLEG-VEKTRLTLEQQTAEV-YKAIEDKMTTAADKRD 181 A+ + E++++A + ELR ++ + E +E+ R+ E+Q AE+ Y+ + A + Sbjct: 60 AEAKAQEDRKQA-LEELRKKMNEEREQCLEQARIRAEEQMAEIRYRCEIAEKKRARLAWE 118 Query: 182 ENLKKMIERLREHEEQ 229 + +K+ + L+E E+ Sbjct: 119 KYMKEKSDALKEAAER 134 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 29.1 bits (62), Expect = 4.8 Identities = 27/118 (22%), Positives = 54/118 (45%), Gaps = 2/118 (1%) Frame = +1 Query: 163 SCRQARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEK-LQQAADRRLLIEAEQ 339 S + R +PQ+ D+ +AR SS+ +P+ + + Q+K + A R+ + + Sbjct: 471 SHKTKRSKPQDQDKQAARPRQASSKTKTSKPQDQDKQDQHKQDKQASRQATRQARQASHK 530 Query: 340 REKLRNHNIKLAEVRSAATAKVEEITKDIENKLT-TAELNREKEIQKKLDFVKKXERP 510 K ++ + + A R A+ +D E + T + +R+ + K D K+ RP Sbjct: 531 TNKPQDQDKQAARPRQASRKTKTSKPQDQEKQATRPRQASRKTKTSKPQD--KQAARP 586 >SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) Length = 635 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG+ AGRR Sbjct: 554 EPPATRPKHPGQVKAGRR 571 >SB_3881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG+ AGRR Sbjct: 254 EPPATRPKHPGQVEAGRR 271 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 29.1 bits (62), Expect = 4.8 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = +2 Query: 29 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENL-KKMIE 205 +KR+ + + + + K+ +E EK R QQ E + ++ D+R+++L KK E Sbjct: 143 KKRDEFWTQEQQKEKERIEE-EKNRAAAHQQELERKRKEREEKQQEVDEREDHLQKKRSE 201 Query: 206 RLREHEEQVRKVRA 247 LR +E++++ A Sbjct: 202 SLR--KERMKEAEA 213 >SB_9039| Best HMM Match : M (HMM E-Value=0.00046) Length = 716 Score = 29.1 bits (62), Expect = 4.8 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 5/85 (5%) Frame = +2 Query: 2 VDAKMETHE---EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIE--DKMTTA 166 V A++E E EK+ ++E +S + E + R L + TAE A +++ Sbjct: 528 VQAELENQEKDVEKKRKKLDEEKSNFEAEREQLNDNRRALSENTAEEATAGSNLEEIQRK 587 Query: 167 ADKRDENLKKMIERLREHEEQVRKV 241 ++ E ++++ R +E +E+V K+ Sbjct: 588 INRSREEMQQIERRKKELQEEVDKL 612 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 29.1 bits (62), Expect = 4.8 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 6/71 (8%) Frame = +2 Query: 29 EKREAYINELRSRLKDHLEGVEK------TRLTLEQQTAEVYKAIEDKMTTAADKRDENL 190 E+++A R L++ L+ +E+ T+L L Q+TAE YK DK+ A +R L Sbjct: 418 EQKQAEEERCRKELEEKLQTLERDSHKYRTKLELAQKTAETYK---DKLEAEARER-ARL 473 Query: 191 KKMIERLREHE 223 M E ++ E Sbjct: 474 MMMYESPKKEE 484 >SB_53183| Best HMM Match : Ras (HMM E-Value=0) Length = 834 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +1 Query: 310 DRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKE 468 DRR++ + R H I+ E + +E+ + + + ELN++ E Sbjct: 171 DRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKKELNKDSE 223 >SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG+ AGRR Sbjct: 803 EPPATRPKHPGQIEAGRR 820 >SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 187 EPPATRPKHPGRVGAGRR 204 >SB_8393| Best HMM Match : DUF662 (HMM E-Value=3.9e-26) Length = 319 Score = 28.7 bits (61), Expect = 6.3 Identities = 17/65 (26%), Positives = 35/65 (53%) Frame = +1 Query: 250 QPEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIE 429 +PE+ Q +E + EKLQQ + + E ++++ +KL ++ A AK ++ ++ Sbjct: 127 EPERIQAIELSALEKLQQ-KQKEIEDENKKKKAALQETLKLRYRKTQAEAKTLQLVQNEL 185 Query: 430 NKLTT 444 + L T Sbjct: 186 SHLDT 190 Score = 28.7 bits (61), Expect = 6.3 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Frame = +1 Query: 274 ESAIQEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATA----KVEEITKDIENKLT 441 ++A+QE L+ R+ EA+ + ++N L + SA A K+EE +D Sbjct: 157 KAALQETLKLRY-RKTQAEAKTLQLVQNELSHLDTLLSADVAILRDKIEEAARDFAQAQK 215 Query: 442 TAELNREKEIQKKLDFVKKXER 507 E ++ ++ KLD +K ER Sbjct: 216 RYERAEKEFVESKLDLHRKTER 237 >SB_54201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 403 VEEITKD-IENKLTTAELNREKEIQKKLDFVKK 498 V T D + K AELNR+KEI+KK+ K Sbjct: 99 VHTFTADMLAQKQAAAELNRQKEIEKKIKKTSK 131 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 252 TGEVPAARERHPGEAAAGRR 311 + E PA R +HPG AGRR Sbjct: 2005 SSEPPATRPKHPGRVEAGRR 2024 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +1 Query: 352 RNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREKEIQKKLDFVK 495 +N+NIK + + +TAK E + + K E R+++ +KK D VK Sbjct: 279 KNNNIKKLKNGAKSTAKDESLKRLKPKKDQVLEAKRKEDSEKKRDEVK 326 >SB_12080| Best HMM Match : p450 (HMM E-Value=0) Length = 522 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = -2 Query: 715 LIRKGVFHGFSVNVSNLTVDXGGRVTDVKSDSCD 614 +++ V HG++ +SN+ D GRV +++S + D Sbjct: 163 MLKPKVVHGYAPELSNVVDDFIGRVNELRSTTSD 196 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/69 (26%), Positives = 37/69 (53%) Frame = +2 Query: 14 METHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLK 193 ++T E+R ++ + L+S++ + E + T + EQ+ E D+ TT +K+ +N K Sbjct: 121 LDTVIERRRSHRDALKSQIHELAEQMMATIMVKEQELCEQV----DRQTTEHEKKYKNQK 176 Query: 194 KMIERLREH 220 M + E+ Sbjct: 177 VMYKNFVEN 185 >SB_59554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1247 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 636 EPPATRPKHPGRVEAGRR 653 >SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) Length = 1020 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 570 EPPATRPKHPGRVEAGRR 587 >SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/72 (27%), Positives = 36/72 (50%) Frame = +2 Query: 2 VDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRD 181 V+ + HEEK NE + L E +K L ++T E+ +ED+ A +D Sbjct: 399 VEKMTKDHEEKIAKIKNENQRALALKDEDAQK----LMKETEELKAKMEDEHQKALGLKD 454 Query: 182 ENLKKMIERLRE 217 E+++K+++ E Sbjct: 455 EDIQKLMKETDE 466 >SB_52772| Best HMM Match : rve (HMM E-Value=0.001) Length = 646 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 87 EPPATRPKHPGRVEAGRR 104 >SB_50440| Best HMM Match : SOUL (HMM E-Value=1.7) Length = 437 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 168 EPPATRPKHPGRVEAGRR 185 >SB_50296| Best HMM Match : TP2 (HMM E-Value=9.8) Length = 278 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 186 EPPATRPKHPGRVEAGRR 203 >SB_50235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 501 EPPATRPKHPGRVEAGRR 518 >SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) Length = 937 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 687 EPPATRPKHPGRVEAGRR 704 >SB_45991| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.074) Length = 134 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = +2 Query: 11 KMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADK 175 +M+ EE+ E +NE+ + K E ++K R +E+ ++ +DK + A+ K Sbjct: 5 EMKKKEERMEKQMNEIMAENKRLTEPLQKAREEVEELRKQLANYEKDKASLASAK 59 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +2 Query: 53 ELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIED---KMTTAADKRDENLKKMIERLREHE 223 E+R L D +EGVE + LE Q + IE+ K+ A R L K +E + + Sbjct: 226 EMRKVLHDSMEGVEAEKRELENQAQNCKQEIEEATNKIIEAVLVRKNTLLKDLELVSDCT 285 Query: 224 EQ 229 Q Sbjct: 286 RQ 287 >SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) Length = 624 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 472 EPPATRPKHPGRVEAGRR 489 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 961 EPPATRPKHPGRVKAGRR 978 >SB_43260| Best HMM Match : Gemini_mov (HMM E-Value=0.94) Length = 294 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 46 EPPATRPKHPGRVEAGRR 63 >SB_43173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 502 EPPATRPKHPGRVEAGRR 519 >SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) Length = 2322 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/82 (21%), Positives = 41/82 (50%) Frame = +2 Query: 2 VDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRD 181 ++ KM + +E+ + + R + E +++ E++ A +EDKM +K+ Sbjct: 182 LELKMTSQQEQWDELYESVTQRNNEIQERLKQLE---EEEEARKRAELEDKMRRENEKKR 238 Query: 182 ENLKKMIERLREHEEQVRKVRA 247 + ++ L++ EE+ R+ RA Sbjct: 239 KEEERAEAELKKKEEEERQRRA 260 >SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 961 Score = 28.3 bits (60), Expect = 8.3 Identities = 27/121 (22%), Positives = 55/121 (45%), Gaps = 14/121 (11%) Frame = +1 Query: 172 QARREPQEDDRASART*GTSSQGPRRQPEKFQQLESAIQEKL----------QQAADRRL 321 Q + + E RA R + R Q E +++ +Q+++ + A+R L Sbjct: 160 QTQDQEIESLRAELRKSKAELKAGRSQNEDYKKTLELLQDRIKARARAAGQGEDDAERSL 219 Query: 322 LIEAEQREKLRNHNIKLAEVRSAA----TAKVEEITKDIENKLTTAELNREKEIQKKLDF 489 + Q+E+L+ HN+ L E R AA K+ D+E +L + + + +++L+ Sbjct: 220 KSDNLQKEQLQTHNMAL-ETRLAALIKELGKLRSEKSDLEERLQSMQKRNADQEERELEA 278 Query: 490 V 492 + Sbjct: 279 I 279 >SB_40442| Best HMM Match : zf-MYM (HMM E-Value=2.7) Length = 235 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 98 EPPATRPKHPGRVEAGRR 115 >SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 1144 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 832 EPPATRPKHPGRVKAGRR 849 >SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) Length = 419 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 48 EPPATRPKHPGRVEAGRR 65 >SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) Length = 1014 Score = 28.3 bits (60), Expect = 8.3 Identities = 18/74 (24%), Positives = 35/74 (47%) Frame = +1 Query: 286 QEKLQQAADRRLLIEAEQREKLRNHNIKLAEVRSAATAKVEEITKDIENKLTTAELNREK 465 + +++Q+ L E + E + +L E A DIE K+ A+ RE+ Sbjct: 551 ETRMKQSTHHLQLEEIKTLENNLDEQQQLIEKSKETIALATAKCNDIELKMKEAKTYRER 610 Query: 466 EIQKKLDFVKKXER 507 E++K + +KK ++ Sbjct: 611 ELKKAEEDLKKAKK 624 >SB_33182| Best HMM Match : rve (HMM E-Value=0.00043) Length = 801 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +2 Query: 53 ELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIED---KMTTAADKRDENLKKMIERLREHE 223 E+R L D +EGVE + LE Q + IE+ K+ A R L K +E + + Sbjct: 226 EMRKVLHDSMEGVEAEKRELENQAQNCKQEIEEATNKIIEAVLVRKNTLLKDLELVSDCT 285 Query: 224 EQ 229 Q Sbjct: 286 RQ 287 >SB_27883| Best HMM Match : TrbF (HMM E-Value=1.5) Length = 389 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_23918| Best HMM Match : rve (HMM E-Value=0.013) Length = 1785 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 1204 EPPATRPKHPGRVEAGRR 1221 >SB_20408| Best HMM Match : rve (HMM E-Value=0.0034) Length = 887 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 357 EPPATRPKHPGRVKAGRR 374 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 1218 EPPATRPKHPGRVEAGRR 1235 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 620 EPPATRPKHPGRVKAGRR 637 >SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) Length = 1667 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 1086 EPPATRPKHPGRVEAGRR 1103 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 6/65 (9%) Frame = +1 Query: 310 DRRLLIEAEQREKLRNHNIKLAEVRSAAT-AKVEEIT-----KDIENKLTTAELNREKEI 471 DR+ IE+ + H+++L VR + T K E+ KD E K A++ EK+ Sbjct: 68 DRQRAIESVTKRLHGEHSVELRRVRDSITKEKDNELRQIVKFKDEECKALKAQITEEKDK 127 Query: 472 QKKLD 486 K+L+ Sbjct: 128 NKRLE 132 >SB_11351| Best HMM Match : LRV (HMM E-Value=6) Length = 194 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_11059| Best HMM Match : KID (HMM E-Value=0.046) Length = 296 Score = 28.3 bits (60), Expect = 8.3 Identities = 19/71 (26%), Positives = 36/71 (50%) Frame = +2 Query: 29 EKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIER 208 E R I++L LKD + + TLEQ A++ + +E K A+K + + ++ + Sbjct: 56 EDRGKSIDKLEKELKDQEAKHNRQKNTLEQTVAKMKEVMERKGGN-ANKVNARVAELEKE 114 Query: 209 LREHEEQVRKV 241 L+E + K+ Sbjct: 115 LKEKTKSAEKL 125 >SB_10207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1105 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 777 EPPATRPKHPGRVEAGRR 794 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 294 EPPATRPKHPGRVEAGRR 311 >SB_3288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 58 EPPATRPKHPGRVEAGRR 75 >SB_1077| Best HMM Match : rve (HMM E-Value=2.1e-17) Length = 794 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 211 EPPATRPKHPGRVEAGRR 228 >SB_56908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 113 EQQTAEVYKAIEDKMTTAADKRDENLKKMIERLREHEEQVRKVRAG 250 E T + KAIE +T +D NLK R H++ V +G Sbjct: 154 ECATRRILKAIEGHLTLTSDSEGCNLKSSFGIRRSHKDPVTLYESG 199 >SB_51707| Best HMM Match : TP2 (HMM E-Value=6.3) Length = 396 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 170 DKRDENLKKMIERLREHEEQVRKVRA 247 +KRDE+ KK I RL H++ V +VR+ Sbjct: 321 EKRDESRKKGIARLHFHKQVVDEVRS 346 >SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) Length = 353 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 189 EPPATRPKHPGRVEAGRR 206 >SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) Length = 1141 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 1018 EPPATRPKHPGRVEAGRR 1035 >SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 722 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 294 EPPATRPKHPGRVEAGRR 311 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 769 EPPATRPKHPGRVEAGRR 786 >SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 1204 EPPATRPKHPGRVEAGRR 1221 >SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1608 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 976 EPPATRPKHPGRVEAGRR 993 >SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) Length = 625 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 463 EPPATRPKHPGRVEAGRR 480 >SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) Length = 1264 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 781 EPPATRPKHPGRVEAGRR 798 >SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 1513 EPPATRPKHPGRVEAGRR 1530 >SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 851 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 690 EPPATRPKHPGRVEAGRR 707 >SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1035 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 385 EPPATRPKHPGRVEAGRR 402 >SB_24923| Best HMM Match : rve (HMM E-Value=1.5e-11) Length = 1445 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 1023 EPPATRPKHPGRVEAGRR 1040 >SB_24601| Best HMM Match : DUF934 (HMM E-Value=1.5) Length = 343 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 38 EPPATRPKHPGRVEAGRR 55 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 28.3 bits (60), Expect = 8.3 Identities = 19/71 (26%), Positives = 32/71 (45%) Frame = +2 Query: 26 EEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIE 205 EEK + + ++ K+ LE +K EQ+ E E K +K+ K +E Sbjct: 326 EEKEKQRLEAKAAKEKERLEAKQKK----EQERLEKQAEKEKKEKERLEKKQREEKDRLE 381 Query: 206 RLREHEEQVRK 238 + + EE+ RK Sbjct: 382 KKEKKEEEKRK 392 >SB_23772| Best HMM Match : Remorin_C (HMM E-Value=1.9) Length = 158 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +2 Query: 65 RLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLREHEEQVRK 238 R K E + T L EQ+ + + D + ++R +++M+E L E E V K Sbjct: 71 RQKIAREREQNTYLRAEQEVEKALQKKRDSLGVTDERRPSYVQRMLEDLAETHEDVTK 128 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 28.3 bits (60), Expect = 8.3 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 5/80 (6%) Frame = +2 Query: 17 ETHEEKREA-----YINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEDKMTTAADKRD 181 E E++RE ++N+LR L +L G++ L +TAE AI+D + Sbjct: 443 EAEEQQREITELQKHLNKLRRILSKNLTGIQ---LPNGGETAESEAAIDDFIVKLHQSIG 499 Query: 182 ENLKKMIERLREHEEQVRKV 241 EN K+ +E + + +E + ++ Sbjct: 500 ENPKENMELVNKVKEIITRI 519 >SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 553 EPPATRPKHPGRVEAGRR 570 >SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) Length = 745 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 433 EPPATRPKHPGRVEAGRR 450 >SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 1152 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 788 EPPATRPKHPGRVKAGRR 805 >SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 217 EPPATRPKHPGRVEAGRR 234 >SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) Length = 1146 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +1 Query: 199 DRASART*GTSSQGPRRQPEKFQ--QLESAIQEKLQQ 303 +R++ T SSQ P++QP++ Q QL+ +EKLQQ Sbjct: 638 NRSTYPTHSISSQQPQQQPQQQQLNQLQQQHREKLQQ 674 >SB_1527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 809 EPPATRPKHPGRVEAGRR 826 >SB_308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 258 EVPAARERHPGEAAAGRR 311 E PA R +HPG AGRR Sbjct: 5 EPPATRTKHPGRVEAGRR 22 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,994,887 Number of Sequences: 59808 Number of extensions: 371997 Number of successful extensions: 1956 Number of sequences better than 10.0: 140 Number of HSP's better than 10.0 without gapping: 1659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1938 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -