BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0659 (737 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical ... 33 0.16 AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical ... 33 0.16 Z81567-5|CAB04588.2| 154|Caenorhabditis elegans Hypothetical pr... 30 1.5 AF038605-2|AAB92020.1| 698|Caenorhabditis elegans Hypothetical ... 29 3.4 AF003385-1|AAB54243.1| 884|Caenorhabditis elegans Hypothetical ... 28 7.9 >AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical protein Y59A8B.9 protein. Length = 187 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 213 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPA 82 GPA GA +PSR + +P +T R P+ TP+ P + +P+ Sbjct: 14 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPS 57 >AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical protein Y59A8B.7 protein. Length = 316 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 213 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPA 82 GPA GA +PSR + +P +T R P+ TP+ P + +P+ Sbjct: 143 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPS 186 >Z81567-5|CAB04588.2| 154|Caenorhabditis elegans Hypothetical protein K08C9.7 protein. Length = 154 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = -3 Query: 186 SPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPASQPYTLNR 58 SPS K+F E G R P+G P++S Q+ + +QP TL + Sbjct: 107 SPSPKYFKID--ENGKISRLPTGIPTVSIQREAFMTQPTTLRK 147 >AF038605-2|AAB92020.1| 698|Caenorhabditis elegans Hypothetical protein C02B10.5 protein. Length = 698 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/65 (29%), Positives = 27/65 (41%) Frame = -3 Query: 255 MREVRLVTAATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPASQ 76 MR+++ AA GSM P+ + P H+ PG P P G P + P Sbjct: 379 MRQMQQAAAAAGSMPPSYPSPGQYPGPMHY------PGMPPMMPPGAPFSAGASYPPMGG 432 Query: 75 PYTLN 61 P+ N Sbjct: 433 PFPPN 437 >AF003385-1|AAB54243.1| 884|Caenorhabditis elegans Hypothetical protein R08F11.1 protein. Length = 884 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 516 GNRVTVCLFDCDGTVRRL*SEV 581 G++VT CLFD +GT RL S++ Sbjct: 305 GSKVTTCLFDPNGTGGRLWSDL 326 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,471,093 Number of Sequences: 27780 Number of extensions: 392432 Number of successful extensions: 1152 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1735436670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -