BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0655 (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 3.5 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 4.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 8.0 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 8.0 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 443 ERKKELSKMAVSGLSEDLELPAPRXWICNQ 532 + K+ K AV + + L APR WI N+ Sbjct: 193 DNDKDGYKRAVYKIGQLLTYRAPRPWIYNE 222 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 443 ERKKELSKMAVSGLSEDLELPAPRXWICNQ 532 + K+ K AV + + L APR WI N+ Sbjct: 193 DNDKDGYKRAVYKIGQLLTYRAPRPWIHNE 222 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +1 Query: 451 EGIIQNGGFGVVR 489 +G+I G FG+VR Sbjct: 454 QGVIGEGAFGIVR 466 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 643 SGKVAASVLFQEAXSE*XVQAFGLN 717 +GK+ ASV F E+ S + + G+N Sbjct: 116 AGKLLASVHFAESQSRRILASAGIN 140 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.315 0.132 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,479 Number of Sequences: 336 Number of extensions: 2361 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -