BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0654 (923 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|ch... 29 0.93 SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc... 29 1.2 SPBC83.19c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 6.5 >SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|chr 3|||Manual Length = 923 Score = 29.1 bits (62), Expect = 0.93 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 79 LENRRRVLQKVIVRILQRLS 138 LE+RRR+L+KVIVR R+S Sbjct: 407 LESRRRILEKVIVRESHRMS 426 >SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 987 Score = 28.7 bits (61), Expect = 1.2 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = -1 Query: 512 YVECVTSLTYWLIVXAEEIVSSKDRTLT----PQTPVFCTSTWNFSCTI-ILSSTNKAEL 348 Y+ TYW+I E ++K RT QT C S NFS + I+S+ N A + Sbjct: 793 YINFSNCFTYWIINCILEKKNTKARTAVISFFIQTAYKCLSLQNFSTLMSIVSALNSAPI 852 Query: 347 F 345 + Sbjct: 853 Y 853 >SPBC83.19c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 119 Score = 26.2 bits (55), Expect = 6.5 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = -3 Query: 444 RQNFDPTNTSFLHVHLEFFLHDHPLVNEQS*AFLQRPDGSFLLIP 310 + NF+ + H+HL + H H + QS ++ P+ F P Sbjct: 22 KANFESIRINLQHMHLYHYEHIHLFTSSQS--YMYHPNARFSYSP 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,548,194 Number of Sequences: 5004 Number of extensions: 71818 Number of successful extensions: 187 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 467341524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -