BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0652 (846 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15960.1 68417.m02423 epoxide hydrolase, putative similar to ... 37 0.015 At2g26750.1 68415.m03208 epoxide hydrolase, putative strong simi... 36 0.034 At3g51000.1 68416.m05584 epoxide hydrolase, putative similar to ... 35 0.078 At4g02340.1 68417.m00318 epoxide hydrolase, putative similar to ... 33 0.18 At3g05600.1 68416.m00622 epoxide hydrolase, putative similar to ... 33 0.24 At2g26740.1 68415.m03207 epoxide hydrolase, soluble (sEH) identi... 32 0.42 At4g15955.1 68417.m02422 epoxide hydrolase-related similar to ep... 31 0.96 At2g23420.1 68415.m02796 nicotinate phosphoribosyltransferase fa... 28 6.8 At5g56325.1 68418.m07030 hypothetical protein 28 9.0 >At4g15960.1 68417.m02423 epoxide hydrolase, putative similar to epoxide hydrolase [Solanum tuberosum] GI:407944; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 375 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +2 Query: 185 HKNIKVNGHKTTITLKAGDPSEALNDFSYMV-FLNFWYSWRYQILEFKKDYWWHSPLNMR 361 HK +KVNG + K G S ++ F WY+WR+Q++ + ++R Sbjct: 56 HKTLKVNGINMHVAEKPGSGSGEDPIILFLHGFPELWYTWRHQMVALSSLGYRTIAPDLR 115 Query: 362 GYGD 373 GYGD Sbjct: 116 GYGD 119 >At2g26750.1 68415.m03208 epoxide hydrolase, putative strong similarity to ATsEH [Arabidopsis thaliana] GI:1109600 Length = 320 Score = 35.9 bits (79), Expect = 0.034 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +2 Query: 185 HKNIKVNGHKTTITLKAGDPSEALNDFSYMVFLNFWYSWRYQILEFKKDYWWHSPLNMRG 364 H+N++ NG + ++ PS+ F WYSWR+QI + ++RG Sbjct: 3 HRNVRGNGIDIHVAIQG--PSDGTIVLLLHGFPELWYSWRHQISGLAARGYRAVAPDLRG 60 Query: 365 YGD 373 YGD Sbjct: 61 YGD 63 >At3g51000.1 68416.m05584 epoxide hydrolase, putative similar to epoxide hydrolase [Glycine max] GI:2764806; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 323 Score = 34.7 bits (76), Expect = 0.078 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +2 Query: 188 KNIKVNGHKTTITLKAGDPSEALNDFSYMVFLNFWYSWRYQILEFKKDYWWH--SPLNMR 361 K IK NG + K GD L + F WYSWR+QI +F + +H +P ++R Sbjct: 8 KKIKTNGIWLNVAEK-GDEEGPLVLLLHG-FPETWYSWRHQI-DFLSSHGYHVVAP-DLR 63 Query: 362 GYGD 373 GYGD Sbjct: 64 GYGD 67 >At4g02340.1 68417.m00318 epoxide hydrolase, putative similar to epoxide hydrolases from Glycine max GI:2764806, Solanum tuberosum GI:407938; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 324 Score = 33.5 bits (73), Expect = 0.18 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 278 FLNFWYSWRYQILEFKKDYWWHSPLNMRGYGD 373 F + WYSWR+Q++ F + ++RGYGD Sbjct: 33 FPDLWYSWRHQLVSFAALGYRAIAPDLRGYGD 64 >At3g05600.1 68416.m00622 epoxide hydrolase, putative similar to epoxide hydrolase from [Glycine max] GI:2764806, [Arabidopsis thaliana] GI:1109600; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 331 Score = 33.1 bits (72), Expect = 0.24 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +2 Query: 185 HKNIKVNGHKTTITLKAGDPSEALNDFSYMVFLNFWYSWRYQILEFKKDYWWHSPLNMRG 364 H+ + VNG T+ + P E F + WY+WR+QI + ++RG Sbjct: 6 HRMVSVNG--ITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQISGLSSLGYRAVAPDLRG 63 Query: 365 YGD 373 YGD Sbjct: 64 YGD 66 >At2g26740.1 68415.m03207 epoxide hydrolase, soluble (sEH) identical to ATsEH [Arabidopsis thaliana] GI:1109600 Length = 321 Score = 32.3 bits (70), Expect = 0.42 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = +2 Query: 197 KVNGHKTTITLKAGDPSEALNDFSYMVFLNFWYSWRYQILEFKKDYWWHSPLNMRGYGD 373 KV G+ I + PS+ F WYSWR+QI + ++RGYGD Sbjct: 5 KVRGNGIDIHVAIQGPSDGPIVLLLHGFPELWYSWRHQIPGLAARGYRAVAPDLRGYGD 63 >At4g15955.1 68417.m02422 epoxide hydrolase-related similar to epoxide hydrolase GI:1109600 from [Arabidopsis thaliana] Length = 178 Score = 31.1 bits (67), Expect = 0.96 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = +2 Query: 185 HKNIKVNGHKTTITLKAGDPSEALNDF---SYMVFLN----FWYSWRYQILEFKKDYWWH 343 H +KVNG T+ + PS A N ++FL+ WY+WR+Q++ + Sbjct: 7 HSFVKVNG--ITMHVAEKSPSVAGNGAIRPPVILFLHGFPELWYTWRHQMVALSSLGYRT 64 Query: 344 SPLNMRGYGD 373 ++RGYGD Sbjct: 65 IAPDLRGYGD 74 >At2g23420.1 68415.m02796 nicotinate phosphoribosyltransferase family protein / NAPRTase family protein contains Pfam domain PF04095: Nicotinate phosphoribosyltransferase (NAPRTase) Length = 557 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -3 Query: 760 HGYLQGSFPLEDKLASGQPQGLDGKTRXRSYQXHLRNWLLK 638 H Y+ SF D++ + DGKT + H++ WL K Sbjct: 222 HAYVS-SFMSTDEIVDKVLRSADGKTTCEDFVSHVQTWLKK 261 >At5g56325.1 68418.m07030 hypothetical protein Length = 264 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 434 CRQWSQNLTC*AGDIFNSFGNLRILACST 348 C S+N++ AG+IFN +LR+ C T Sbjct: 120 CLPTSKNVSYPAGNIFNRLVHLRLCTCET 148 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,774,043 Number of Sequences: 28952 Number of extensions: 451312 Number of successful extensions: 920 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1960634400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -