BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0648 (747 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protei... 89 3e-18 At1g64410.1 68414.m07301 hypothetical protein 31 1.1 At1g52960.1 68414.m05990 hypothetical protein very low similarit... 31 1.1 At1g22960.1 68414.m02869 pentatricopeptide (PPR) repeat-containi... 28 7.6 At5g50335.1 68418.m06234 expressed protein 27 10.0 At3g42320.1 68416.m04373 hypothetical protein various predicted ... 27 10.0 At1g54130.1 68414.m06171 RelA/SpoT protein, putative (RSH3) iden... 27 10.0 >At2g35040.1 68415.m04299 AICARFT/IMPCHase bienzyme family protein similar to SP|P12048 Bifunctional purine biosynthesis protein purH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) (AICAR transformylase); IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP synthetase) (ATIC)] {Bacillus subtilis}; contains Pfam profiles PF01808: AICARFT/IMPCHase bienzyme, PF02142: MGS-like domain Length = 596 Score = 89.0 bits (211), Expect = 3e-18 Identities = 43/79 (54%), Positives = 54/79 (68%) Frame = +2 Query: 5 ASNGKLALLSVSDKTGLLSLAKSLSECGLQLIASGGTARXLRNAGLTVQDVSDITRAPEM 184 +S K AL+S+SDK L SL L E G ++++GGTA L NAG++V V +T PEM Sbjct: 68 SSGEKQALISLSDKRDLASLGNGLQELGYTIVSTGGTASTLENAGVSVTKVEKLTHFPEM 127 Query: 185 LGGRVKTLHPAVHAGILAR 241 L GRVKTLHP +H GILAR Sbjct: 128 LDGRVKTLHPNIHGGILAR 146 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/38 (52%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = +1 Query: 295 VVVCNLYPFVQTVSKPD-VTVADAVENIDIGGVTLLRA 405 VVV NLYPF + V+ P ++ D +ENIDIGG ++RA Sbjct: 166 VVVVNLYPFYEKVTAPGGISFEDGIENIDIGGPAMIRA 203 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 411 KNHDRVTVVCDPADYDAVVKEIKENKHHQ 497 KNH V +V D DY AV++ +K + Q Sbjct: 206 KNHKDVLIVVDSGDYQAVLEYLKGGQSDQ 234 >At1g64410.1 68414.m07301 hypothetical protein Length = 1231 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 411 KNHDRVTVVCDPADYDAVVKEIKENKHH 494 K HDRVTV +P D D KE E K + Sbjct: 582 KGHDRVTVTVEPNDQDTAKKEKDEVKDY 609 >At1g52960.1 68414.m05990 hypothetical protein very low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 996 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 411 KNHDRVTVVCDPADYDAVVKEIKENKHH 494 K HDRVTV +P D D KE E K + Sbjct: 208 KGHDRVTVTVEPNDQDTAKKEKDEVKDY 235 >At1g22960.1 68414.m02869 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 718 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 396 EGHAADVDVLDRVRHGHVRLRYRLDERVQVTDHHAYHLVLLTFHV 262 +G+A + +R G +RL E + TDHHA L + + Sbjct: 478 DGYAYTTRAVGELRLGDSDKAFRLHEEMVATDHHAPDLTIYNVRI 522 >At5g50335.1 68418.m06234 expressed protein Length = 74 Score = 27.5 bits (58), Expect = 10.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 241 IIRLCQEDMKRQKYEMISVVVCN 309 II+ C+ED + QK +M S+ CN Sbjct: 14 IIKRCKEDDRHQKKKMQSITNCN 36 >At3g42320.1 68416.m04373 hypothetical protein various predicted Helicases, Arabidopsis thaliana Length = 541 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 411 KNHDRVTVVCDPADYDAVVKEIKE 482 K HDRVTV +P + D KE E Sbjct: 342 KEHDRVTVTIEPNNQDTTKKEKDE 365 >At1g54130.1 68414.m06171 RelA/SpoT protein, putative (RSH3) identical to RSH3 (RelA/SpoT homolog) GI:7141308 from [Arabidopsis thaliana]; contains Pfam profiles PF01966: HD domain, PF04607: Region found in RelA / SpoT proteins Length = 712 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +1 Query: 43 QDGSTLVSKEPVGMWP--AVDCQWRYRQXASERRP 141 +DGS++ S EP+ +P A DC + Y+ ++ P Sbjct: 565 KDGSSICSSEPLCSFPSHAEDCPFSYKPSGNQEGP 599 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,398,974 Number of Sequences: 28952 Number of extensions: 306835 Number of successful extensions: 918 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -