BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0647 (848 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ001515-1|CAA04798.1| 4870|Homo sapiens ryanodine receptor 3 pr... 31 5.3 AB001025-1|BAA23795.1| 4866|Homo sapiens brain ryanodine recepto... 31 5.3 >AJ001515-1|CAA04798.1| 4870|Homo sapiens ryanodine receptor 3 protein. Length = 4870 Score = 31.1 bits (67), Expect = 5.3 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 139 HLLPIISLKSCFYLQKWILRVARQLLPAVRPICLKNDLRPLLIVQCRIVKIRN 297 H++ +I C YL W R L P+ P C K L ++ I+KI N Sbjct: 3129 HVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKIIN 3181 >AB001025-1|BAA23795.1| 4866|Homo sapiens brain ryanodine receptor protein. Length = 4866 Score = 31.1 bits (67), Expect = 5.3 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 139 HLLPIISLKSCFYLQKWILRVARQLLPAVRPICLKNDLRPLLIVQCRIVKIRN 297 H++ +I C YL W R L P+ P C K L ++ I+KI N Sbjct: 3130 HVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKIIN 3182 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,739,067 Number of Sequences: 237096 Number of extensions: 2293818 Number of successful extensions: 5389 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5389 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10761200974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -