BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0647 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 3.6 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 4.7 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 23.0 bits (47), Expect = 3.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 405 GKMSSSVERGSRGEHTNSD 461 GK + V RG+RGEHT ++ Sbjct: 301 GKFNLQV-RGTRGEHTEAE 318 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 4.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 492 SNDIPLYKVIDRSWCAHPDYLSLPSCSFSLIFPFP 388 SND+P + D +P Y P+ ++S PFP Sbjct: 276 SNDLPYLEEFDWQKPFYPGY--YPTMTYSNGLPFP 308 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 234,011 Number of Sequences: 438 Number of extensions: 5421 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -