BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0645 (850 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23885| Best HMM Match : Peptidase_S10 (HMM E-Value=0) 73 4e-13 SB_31326| Best HMM Match : rve (HMM E-Value=6.1e-07) 32 0.51 SB_9645| Best HMM Match : DUF101 (HMM E-Value=4.3) 31 0.89 SB_43370| Best HMM Match : RhoGAP (HMM E-Value=1.6e-18) 31 0.89 SB_21655| Best HMM Match : 7tm_1 (HMM E-Value=9.6e-30) 31 1.2 SB_50363| Best HMM Match : PHO4 (HMM E-Value=0) 31 1.6 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 30 2.1 SB_53279| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.1 SB_49675| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.1 SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 30 2.1 SB_30405| Best HMM Match : rve (HMM E-Value=5.1e-07) 30 2.1 SB_15390| Best HMM Match : rve (HMM E-Value=5.2e-36) 30 2.1 SB_10309| Best HMM Match : rve (HMM E-Value=9.6e-32) 30 2.1 SB_1714| Best HMM Match : rve (HMM E-Value=9.6e-32) 30 2.1 SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_35114| Best HMM Match : RVT_1 (HMM E-Value=2.2e-11) 30 2.1 SB_9297| Best HMM Match : RVT_1 (HMM E-Value=7e-21) 30 2.1 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 30 2.1 SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) 30 2.7 SB_33553| Best HMM Match : DUF101 (HMM E-Value=3.7) 30 2.7 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 30 2.7 SB_19549| Best HMM Match : DUF101 (HMM E-Value=3.7) 30 2.7 SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 30 2.7 SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) 30 2.7 SB_48115| Best HMM Match : rve (HMM E-Value=5.3e-36) 29 4.8 SB_34318| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-30) 29 4.8 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 29 6.3 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 29 6.3 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 29 6.3 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 29 6.3 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 29 6.3 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 6.3 SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_6798| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_5933| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 6.3 SB_2170| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 29 6.3 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 29 6.3 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 6.3 SB_43612| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_42594| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 6.3 SB_39589| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_37146| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_36046| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 6.3 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 6.3 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 6.3 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 6.3 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_53772| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) 28 8.3 SB_38291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_23885| Best HMM Match : Peptidase_S10 (HMM E-Value=0) Length = 446 Score = 72.5 bits (170), Expect = 4e-13 Identities = 46/156 (29%), Positives = 79/156 (50%), Gaps = 4/156 (2%) Frame = +1 Query: 265 SNQFFWYFPAMVPNSK--NAPVIVWLQGGPGATSL-YGLFTENGPIWVRNKKFERRKYNW 435 ++ F+W + A S+ N P+I+WLQGGPG +S YG F E GP+ V K R +W Sbjct: 44 AHMFWWLYGARGEPSERENKPLILWLQGGPGGSSTGYGNFMELGPLDVNLK---LRNTSW 100 Query: 436 ALSHHIIYIDNPVGTGFSFTKNPKATVLMRLKLANSYTPLXXXXXXCFQNFKPI-IFL*L 612 +++++DNPVG GFS+ + A +A + F+ I +++ Sbjct: 101 VEVANVLFVDNPVGAGFSYVTDKGAYTTNVTGIAQDLLTMFKAFVNEMPAFQTIPLYIFC 160 Query: 613 ENHMEESMYQLWAYTIHXKNPTAQIKINMKGIAIGN 720 E++ M + T++ +I+ N KG+A+G+ Sbjct: 161 ESY-GGKMTSAFGVTLYNAIQQGEIRCNFKGVALGD 195 >SB_31326| Best HMM Match : rve (HMM E-Value=6.1e-07) Length = 330 Score = 32.3 bits (70), Expect = 0.51 Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +1 Query: 10 HEAIRH--VSSFVVDNHFVRXPGLPASLSEIKSRRA 111 HE++ H V+ F NHFVR LP SL EIKS +A Sbjct: 193 HESLCHPGVTRF---NHFVRTKNLPYSLEEIKSMKA 225 >SB_9645| Best HMM Match : DUF101 (HMM E-Value=4.3) Length = 360 Score = 31.5 bits (68), Expect = 0.89 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H S NHFVR LP SL EIKS Sbjct: 263 HESLCH-SGVTRLNHFVRTKNLPYSLEEIKS 292 >SB_43370| Best HMM Match : RhoGAP (HMM E-Value=1.6e-18) Length = 865 Score = 31.5 bits (68), Expect = 0.89 Identities = 15/42 (35%), Positives = 28/42 (66%) Frame = +1 Query: 643 LWAYTIHXKNPTAQIKINMKGIAIGNGLSDLYISSCMVNIVS 768 L+A I+ K+P+A +K + +G+SDL +SS +V++V+ Sbjct: 669 LYAEGIYRKSPSAVAVRALKNAIVSSGISDLDLSSHVVHVVA 710 >SB_21655| Best HMM Match : 7tm_1 (HMM E-Value=9.6e-30) Length = 343 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = -2 Query: 783 SIXPIGYDIYHTRADVQVTQXIXYCNTLHINFNLCCR-IFLVNCVGPELVHTFLHMILQS 607 S P+ YDI+ T + + + C NF C R IF N +GP + T LQ+ Sbjct: 277 SYLPVMYDIFVTMSFMSFVINLYICFMFSENFRKCLRQIFCRNRIGPITISTQATRSLQN 336 Query: 606 Q 604 + Sbjct: 337 R 337 >SB_50363| Best HMM Match : PHO4 (HMM E-Value=0) Length = 608 Score = 30.7 bits (66), Expect = 1.6 Identities = 51/180 (28%), Positives = 77/180 (42%), Gaps = 10/180 (5%) Frame = -2 Query: 780 IXPIGYDIYHTRADVQVTQXIXYC-NTLHINFNL--CCRIFLVNCVG--PELV-HTFLHM 619 I IGYD+Y DV + I +L I NL CC I +VN G +LV + L + Sbjct: 183 IASIGYDVYQLLTDVVKPKIIVVAYESLKIKENLSWCCEIVVVNGAGRTDKLVAYESLEL 242 Query: 618 -ILQSQKNYWFEVLETTGRTGSEWSITVR-QLESHQHSSFRIFSETESSANRVVNVYNMM 445 +L K + VL T +G ++ VR L RI E + V +Y Sbjct: 243 QMLHFNKIPLYGVLILTFGSGIVTALFVRFYLVGFMRR--RIIREVDQLGIDVKAMYTPD 300 Query: 444 TEGPVILSSLKLLI-ANPYRTV-FCEESIQRCSARASLEPDDNRCVFAVRNHSRKVPEEL 271 + +L ++++I N TV E S + +A S++P+ N + N K EL Sbjct: 301 VDPAELLQRVEVIIEENEDLTVHIFEISDEVEAAEKSVDPEANGDTSKLSNGVTKPAREL 360 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 791 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 824 >SB_53279| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 337 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 75 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 108 >SB_49675| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 412 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 60 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 93 >SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 998 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 838 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 871 >SB_30405| Best HMM Match : rve (HMM E-Value=5.1e-07) Length = 409 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 249 HESLCHPGVTRL-NHFVRTKNLPYSLGEIKSMTSK 282 >SB_15390| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 748 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 393 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 426 >SB_10309| Best HMM Match : rve (HMM E-Value=9.6e-32) Length = 546 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 220 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 253 >SB_1714| Best HMM Match : rve (HMM E-Value=9.6e-32) Length = 517 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 220 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 253 >SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 939 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 972 >SB_35114| Best HMM Match : RVT_1 (HMM E-Value=2.2e-11) Length = 512 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 348 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 381 >SB_9297| Best HMM Match : RVT_1 (HMM E-Value=7e-21) Length = 1032 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 454 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 487 >SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1677 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKSRRAR 114 HE++ H + NHFVR LP SL EIKS ++ Sbjct: 822 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKSMTSK 855 >SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) Length = 615 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP SL EIKS Sbjct: 388 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKS 417 >SB_33553| Best HMM Match : DUF101 (HMM E-Value=3.7) Length = 252 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP SL EIKS Sbjct: 220 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKS 249 >SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) Length = 1022 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP SL EIKS Sbjct: 564 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKS 593 >SB_19549| Best HMM Match : DUF101 (HMM E-Value=3.7) Length = 225 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP SL EIKS Sbjct: 193 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKS 222 >SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP SL EIKS Sbjct: 814 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKS 843 >SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 870 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP SL EIKS Sbjct: 838 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKS 867 >SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) Length = 1046 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP SL EIKS Sbjct: 234 HESLCHPGVTRL-NHFVRTKNLPYSLEEIKS 263 >SB_48115| Best HMM Match : rve (HMM E-Value=5.3e-36) Length = 238 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +1 Query: 49 NHFVRXPGLPASLSEIKS 102 NHFVR LP SL EIKS Sbjct: 6 NHFVRTKNLPYSLEEIKS 23 >SB_34318| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-30) Length = 343 Score = 29.1 bits (62), Expect = 4.8 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = -2 Query: 783 SIXPIGYDIYHTRADVQVTQXIXYCNTLHINFNLCCR-IFLVNCVGPELVHTFLHMILQS 607 S P+ YDI+ T + + C NF C R IF N +GP + T LQ+ Sbjct: 277 SYLPVMYDIFVTMSFMSFVINPYICFMFSENFRKCLRQIFCRNRIGPITISTQATRSLQN 336 Query: 606 Q 604 + Sbjct: 337 R 337 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 95 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 127 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 63 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 95 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 535 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 567 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 613 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 645 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 63 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 95 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 367 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 399 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 144 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 176 >SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 192 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 29 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 61 >SB_6798| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 318 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 155 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 187 >SB_5933| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 11 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 43 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 247 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 279 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 144 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 176 >SB_2170| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 11 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 43 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 63 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 95 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 364 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 396 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 63 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 95 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 2455 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 2487 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 144 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 176 >SB_43612| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 11 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 43 >SB_42594| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 186 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 23 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 55 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 196 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 228 >SB_39589| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 11 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 43 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 179 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 211 >SB_37146| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 11 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 43 >SB_36046| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 11 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 43 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 144 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 176 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 63 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 95 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 179 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 211 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V N + GLP + I+ RR RW G Sbjct: 253 HWSDKVTKNEVLERSGLPTLFTLIRQRRLRWLG 285 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 196 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 228 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 25 HVSSFVVDNHFVRXPGLPASLSEIKSRRARWRG 123 H S V +N + GLP + ++ RR RW G Sbjct: 63 HWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLG 95 >SB_53772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +1 Query: 277 FWYFPAMVPNSKNAPVIVWL-QGGPGATSLYGLFTENGPIWVRNKKFERRKYNWALSHHI 453 FW+ + NS+ + WL QG P + G F G + ++ R WAL + Sbjct: 10 FWFTEFLERNSQFS---AWLFQGRPNTFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVV 66 Query: 454 IYID 465 ++ D Sbjct: 67 LHND 70 >SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4994 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +1 Query: 277 FWYFPAMVPNSKNAPVIVWL-QGGPGATSLYGLFTENGPIWVRNKKFERRKYNWALSHHI 453 FW+ + NS+ + WL QG P + G F G + ++ R WAL + Sbjct: 4920 FWFTEFLERNSQFS---AWLFQGRPNTFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVV 4976 Query: 454 IYID 465 ++ D Sbjct: 4977 LHND 4980 >SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 1048 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 Query: 10 HEAIRHVSSFVVDNHFVRXPGLPASLSEIKS 102 HE++ H + NHFVR LP L EIKS Sbjct: 838 HESLCHPGVTRL-NHFVRTKNLPIPLKEIKS 867 >SB_38291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +1 Query: 277 FWYFPAMVPNSKNAPVIVWL-QGGPGATSLYGLFTENGPIWVRNKKFERRKYNWALSHHI 453 FW+ + NS+ + WL QG P + G F G + ++ R WAL + Sbjct: 114 FWFTEFLERNSQFS---AWLFQGRPNTFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVV 170 Query: 454 IYID 465 ++ D Sbjct: 171 LHND 174 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,549,479 Number of Sequences: 59808 Number of extensions: 546934 Number of successful extensions: 1310 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 1226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -