BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0644 (902 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 25 2.4 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 24 7.3 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 25.4 bits (53), Expect = 2.4 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = -3 Query: 222 LCNSLTAFCPFSKFISSITTTAPSLRN*SAILRPIPSAPPVMATILFFNSRSIFKVAL 49 LC S+ S F+S+I+ TA +L I+ P + +M I I + L Sbjct: 115 LCKSIGTLQATSIFVSTISITAIALDRYQVIVYPTRDSLQLMGAIAILTGIWIISIVL 172 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.8 bits (49), Expect = 7.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 642 VVLSWLSL*TRGIQSRFLPQF 580 VV+ W S RG++ LPQF Sbjct: 170 VVMYWRSTPIRGVEEAELPQF 190 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 879,144 Number of Sequences: 2352 Number of extensions: 19066 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97574436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -