BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0642 (304 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.9 SB_38759| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.9 SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) 25 8.9 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 26.6 bits (56), Expect = 3.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 303 LIYFFIITMTWLLINTIHM 247 L YFF TW+L+ +HM Sbjct: 2532 LHYFFSTVFTWMLVEGVHM 2550 >SB_38759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 25.4 bits (53), Expect = 8.9 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 169 SRSIVKSRSSHLNIITP*DVRPSRLVHMYGINK*PR-HSNNKKIY 300 S++IVK+ ++ +TP D+RP + YG PR H+ ++Y Sbjct: 341 SKAIVKTIMTNDRAVTPNDLRPGDHIVRYGNPLHPRCHAIVIRVY 385 >SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) Length = 1515 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 97 PTWIRLGFALSA*TRIRKTLRAGGSRSI 180 P+WIR A T + KTL AG +R + Sbjct: 113 PSWIRESTAFLFFTWMNKTLNAGNTRRL 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,974,911 Number of Sequences: 59808 Number of extensions: 124620 Number of successful extensions: 205 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 205 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 364677581 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -