BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0640 (580 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 5.4 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 23 7.2 U50475-1|AAA93477.1| 207|Anopheles gambiae protein ( Anopheles ... 23 9.5 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.4 bits (48), Expect = 5.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 257 TVE*RLSGVFLSWQPSFSRPKPHSF 183 T + R G ++SW F++PK SF Sbjct: 271 TKQRRNYGTWISWWVEFAKPKIKSF 295 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 23.0 bits (47), Expect = 7.2 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 184 KECGFGLLKDGCQLRKTPESLYSTVSRKFDSSPAESTPRLQEKNPL 321 K C + KD + + ESLY + + S PA + ++ PL Sbjct: 60 KACTLHVYKDASASQDSSESLYMANAFRNVSVPATKVLKEEKDQPL 105 >U50475-1|AAA93477.1| 207|Anopheles gambiae protein ( Anopheles gambiae putativearylphorin precursor, mRNA, partial cds. ). Length = 207 Score = 22.6 bits (46), Expect = 9.5 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 280 GSNQTFSIPSNKDFLGSFSVGNRLSADRNHI 188 G+ +P + +F G+ N S DRN++ Sbjct: 19 GTRINLRLPESVEFFGNLLNSNVDSVDRNYV 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 535,060 Number of Sequences: 2352 Number of extensions: 8728 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -