BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0639 (845 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1054 + 34133087-34133417,34133546-34133862,34133988-34134158 32 0.66 08_01_0648 + 5602454-5602513,5602913-5603000,5603128-5604248,560... 30 2.0 03_05_0731 - 27213777-27215177,27218188-27218405,27218504-27218648 29 4.7 09_01_0056 + 914117-914464 28 8.1 08_01_0650 + 5617578-5618633,5619580-5619735,5619816-5620058 28 8.1 08_01_0649 + 5607234-5608397,5609358-5609513,5609598-5609796,561... 28 8.1 03_02_0858 + 11848128-11848287,11848906-11848973,11849281-118494... 28 8.1 >01_06_1054 + 34133087-34133417,34133546-34133862,34133988-34134158 Length = 272 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 576 PALKKGQVSPLQYYLPPPAWCRKTVTEVTAKMQCELSPSKXW 701 PAL+ G V P ++ L PP W + V + + C+ ++ W Sbjct: 106 PALRAGNVQPYEFIL-PPTWKQTRVANILSGNYCQPKCAEPW 146 >08_01_0648 + 5602454-5602513,5602913-5603000,5603128-5604248, 5605146-5605217,5605218-5605373,5605458-5605748 Length = 595 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 97 IDPSCTPYFCNNLNDVRISCYISIHTPHMKK 5 IDPS + CNNL V+I+C HM K Sbjct: 507 IDPSGGSFACNNLRKVKITCCKDDEMVHMLK 537 >03_05_0731 - 27213777-27215177,27218188-27218405,27218504-27218648 Length = 587 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = +3 Query: 375 PRQDHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMP--TCSIEQAE 548 P+QD F+ HTS+ T H+ QFR +A+ P R+ P CS++Q E Sbjct: 282 PKQDLFDPPHTSAIVTKLAHT-DQFRCLDKAAIVSGPDDVRAGGAAPSNPWRLCSVQQVE 340 Query: 549 AVRQYYAAFPALKKG 593 V+ P G Sbjct: 341 EVKCLIRIVPVWSTG 355 >09_01_0056 + 914117-914464 Length = 115 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 483 PGHKRSRRFVIGMPTCSIEQAEA 551 P H++ RR+ IGM T ++E A A Sbjct: 83 PAHRKQRRWGIGMATVAVESAVA 105 >08_01_0650 + 5617578-5618633,5619580-5619735,5619816-5620058 Length = 484 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 97 IDPSCTPYFCNNLNDVRISC 38 IDPS + CNNL V+I+C Sbjct: 412 IDPSGGSFACNNLKKVKITC 431 >08_01_0649 + 5607234-5608397,5609358-5609513,5609598-5609796, 5612419-5613608,5614505-5614660,5614742-5615041 Length = 1054 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 97 IDPSCTPYFCNNLNDVRISC 38 IDPS + CNNL V+I+C Sbjct: 448 IDPSGGSFSCNNLEKVKITC 467 >03_02_0858 + 11848128-11848287,11848906-11848973,11849281-11849403, 11850796-11851128,11851199-11851321,11851414-11851632 Length = 341 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 688 GDNSHCILAVTSVTVLRHQAGGGR 617 G+ HCI V+ V+++ AGGGR Sbjct: 293 GEGFHCIRTVSDVSLVLDAAGGGR 316 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,512,357 Number of Sequences: 37544 Number of extensions: 455827 Number of successful extensions: 877 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 877 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -