BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0639 (845 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54257| Best HMM Match : Cache (HMM E-Value=4.4e-09) 33 0.39 SB_22553| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_41115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_8268| Best HMM Match : Rabaptin (HMM E-Value=6.4) 29 3.6 SB_39501| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_32952| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_9499| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_4726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_52709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_43208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_40622| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_23246| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.3e-09) 29 4.7 SB_11805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_8270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_2780| Best HMM Match : Vicilin_N (HMM E-Value=1) 29 4.7 SB_35718| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.8e-09) 29 6.3 SB_24193| Best HMM Match : Acetyltransf_1 (HMM E-Value=5.8e-08) 29 6.3 SB_2448| Best HMM Match : E-MAP-115 (HMM E-Value=0.76) 29 6.3 SB_41476| Best HMM Match : Ribosomal_L17 (HMM E-Value=2.9) 28 8.3 SB_21998| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_39658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_27188| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_11887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_54257| Best HMM Match : Cache (HMM E-Value=4.4e-09) Length = 820 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 82 TPYFCNNLNDVRISCYISIHTP 17 TP +CNNL D+R Y +IH P Sbjct: 722 TPQWCNNLEDLRSQLYYTIHLP 743 >SB_22553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 30.3 bits (65), Expect = 2.1 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P+Q Sbjct: 68 AIAFKRAKSMVGRSCPMQ 85 >SB_41115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.5 bits (63), Expect = 3.6 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASRHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_8268| Best HMM Match : Rabaptin (HMM E-Value=6.4) Length = 214 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/76 (26%), Positives = 32/76 (42%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKKGQVSPLQ 611 AF G+ ++ Sbjct: 68 AIAFKRANDGEFDDIK 83 >SB_39501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_32952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_9499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYTEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_4726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_52709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYTEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_43208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_40622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_23246| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.3e-09) Length = 305 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -3 Query: 204 HAYIFGLLFASVSILDMMHRLTLNIFAIALSLASNE*ILRAPLTSVII 61 H YI G L+A +D+ + +++F LS NE +RAP VII Sbjct: 213 HGYIVGPLYADY--IDVAAVMLISLFEAILSKHGNERQVRAPNICVII 258 >SB_11805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYTEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_8270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.1 bits (62), Expect = 4.7 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_2780| Best HMM Match : Vicilin_N (HMM E-Value=1) Length = 228 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/77 (27%), Positives = 33/77 (42%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D +L + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDEALDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKKGQVSPLQY 614 AF K+ + L Y Sbjct: 68 AIAFKRAKQYLAARLAY 84 >SB_35718| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.8e-09) Length = 305 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -3 Query: 204 HAYIFGLLFASVSILDMMHRLTLNIFAIALSLASNE*ILRAPLTSVII 61 H YI G L+A +D+ + +++F LS NE +RAP VII Sbjct: 213 HGYIVGPLYADS--IDVAAVMLISLFEAILSKHGNERQVRAPNICVII 258 >SB_24193| Best HMM Match : Acetyltransf_1 (HMM E-Value=5.8e-08) Length = 281 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -3 Query: 204 HAYIFGLLFASVSILDMMHRLTLNIFAIALSLASNE*ILRAPLTSVII 61 H YI G L+A +D+ + +++F LS NE +RAP VII Sbjct: 213 HGYIVGPLYADS--IDVAAVMLISLFEAILSKHGNERQVRAPNICVII 258 >SB_2448| Best HMM Match : E-MAP-115 (HMM E-Value=0.76) Length = 319 Score = 28.7 bits (61), Expect = 6.3 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D +L + SA+Y + H R++R V P E+ + Q Sbjct: 236 DVFNVLNFALRDNEALDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQV 295 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 296 AIAFKRAKSMVGRSCPTQ 313 >SB_41476| Best HMM Match : Ribosomal_L17 (HMM E-Value=2.9) Length = 123 Score = 28.3 bits (60), Expect = 8.3 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D +L + SA+Y + H R++R V P E+ + Q Sbjct: 40 DVFNVLNFALRDDEALDTALADVMQTTSALYVASRHTRAQRAVFSQPKAYAEKLQNDHQA 99 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 100 AIAFKRAKSMVGRSCPTQ 117 >SB_21998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.3 bits (60), Expect = 8.3 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D +L + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDEALDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 ATAFKRAKSMVGRSCPTQ 85 >SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +1 Query: 79 GCTKDLFVTS**QCDCENIKSQTVH--HIENRNTSKQQAKDISMY**RRTNKGSIYTHGP 252 GCTKDLF +C ++ + ++ H + Q+ +D++++ T++G +Y G Sbjct: 66 GCTKDLFEMEKLECRRKDARGKSARGAHSLYKQGDPQKHEDLAVWAVIVTHEGKLYRSGQ 125 Query: 253 RDSKMD 270 + +D Sbjct: 126 DGAAID 131 >SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1207 Score = 28.3 bits (60), Expect = 8.3 Identities = 21/65 (32%), Positives = 28/65 (43%) Frame = -1 Query: 671 HFGCDFSDSLTTPSRWRQIILQR*HLPFLQSWKCSVILTYSLCLFYRTRWHTYDKSS*SF 492 HF +D T P W Q +L F+Q +K + L R H +DKSS + Sbjct: 411 HFLRFLTDKRTLPVLWHQCLLT-----FVQRYKEDISSEQKEALMELCRVHVHDKSS-AI 464 Query: 491 MSWRL 477 SW L Sbjct: 465 YSWIL 469 >SB_39658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.3 bits (60), Expect = 8.3 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 2/78 (2%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D +L + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDEALDTALADVMQTTSALYVASRHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALKK--GQVSPLQ 611 AF K G+ P Q Sbjct: 68 AIAFKRAKSMVGRSCPTQ 85 >SB_27188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/68 (29%), Positives = 29/68 (42%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALK 587 AF K Sbjct: 68 AIAFKRAK 75 >SB_11887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.3 bits (60), Expect = 8.3 Identities = 20/68 (29%), Positives = 29/68 (42%) Frame = +3 Query: 384 DHFNTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSRRFVIGMPTCSIEQAEAVRQY 563 D FN L+ + D SL + SA+Y + H R++R V P E+ + Q Sbjct: 8 DVFNVLNFALRDDESLDTALADVMQTTSALYVASCHTRAQRAVFSQPKAYAEKLQNDHQA 67 Query: 564 YAAFPALK 587 AF K Sbjct: 68 AIAFKRAK 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,667,332 Number of Sequences: 59808 Number of extensions: 564003 Number of successful extensions: 1176 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -