BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0638 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 26 4.7 SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccha... 25 8.2 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 26.2 bits (55), Expect = 4.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 354 APMQAPPEPSPSIMAP 401 AP APP P PS+ AP Sbjct: 1116 APSGAPPVPKPSVAAP 1131 Score = 26.2 bits (55), Expect = 4.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 354 APMQAPPEPSPSIMAP 401 AP APP P PS+ AP Sbjct: 1154 APSGAPPVPKPSVAAP 1169 >SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.4 bits (53), Expect = 8.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 296 TCSDRIWHMGCRASPSRTGGSNAGPTRTQPFDH 394 T D++ + C SPSR SNA T P + Sbjct: 488 TAEDQVHNNHCAVSPSRRSSSNALYLATLPMGY 520 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,791,842 Number of Sequences: 5004 Number of extensions: 53314 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -