BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0638 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 5.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 5.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 9.5 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 682 LSVFDXQTSPFCHHPLWVAXKVLGASRQTHRLR 584 + ++D +T+P H + + ++ GA Q H R Sbjct: 29 VGIYDPRTAPHSRHHVHMMPEMHGAYSQVHHHR 61 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 682 LSVFDXQTSPFCHHPLWVAXKVLGASRQTHRLR 584 + ++D +T+P H + + ++ GA Q H R Sbjct: 29 VGIYDPRTAPHSRHHVHMMPEMHGAYSQVHHHR 61 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 355 ATRSRRACTASHVPDPITARPVP 287 +T S A A+ VP+P+ A P P Sbjct: 925 STPSTSAMAATIVPNPVQASPSP 947 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,039 Number of Sequences: 2352 Number of extensions: 13611 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -