BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0635 (572 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0996 + 33667663-33667900,33668019-33668091,33668785-336688... 29 3.5 10_07_0188 + 13921731-13921938,13922076-13922338,13922463-13923257 28 4.6 >01_06_0996 + 33667663-33667900,33668019-33668091,33668785-33668841, 33668970-33669067,33669482-33669637,33669744-33670366, 33670484-33670560,33671551-33671805,33671950-33672067, 33672174-33672345,33672434-33672975 Length = 802 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 473 YTIAXKSTHPEPAGGAFHMTWTSVLGRSSASTTEXVH 363 Y KSTHP+ + H T+VLG S +H Sbjct: 97 YHFKGKSTHPDDVIASHHDMLTTVLGSKEDSLASIIH 133 >10_07_0188 + 13921731-13921938,13922076-13922338,13922463-13923257 Length = 421 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 316 PVCWAPSLCPGSKD 275 PVCWAP PGS D Sbjct: 241 PVCWAPPSAPGSYD 254 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,224,581 Number of Sequences: 37544 Number of extensions: 278609 Number of successful extensions: 633 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -