BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0635 (572 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 0.93 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 2.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.6 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 8.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 8.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 8.7 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 0.93 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 379 VEADDLPKTEVQVMWKAPP 435 + DDL + ++V WK PP Sbjct: 983 IRVDDLDQHTLKVTWKPPP 1001 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 217 GRFPHS*RXTTVXGFKIILDPLNPDTRRAPSKQGQF 324 GR +S R T G + L+ DT+R P + G F Sbjct: 116 GRVLYSSRLTIKAGCPMNLENFPMDTQRCPLQFGSF 151 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 70 ATLKFSDCPFYLGLRRTDPTSPP 2 AT + PF +G RRT P PP Sbjct: 398 ATARNVVAPFLIGSRRTSP--PP 418 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 92 WPDELNPG 115 WP+EL PG Sbjct: 178 WPEELEPG 185 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 92 WPDELNPG 115 WP+EL PG Sbjct: 178 WPEELEPG 185 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 92 WPDELNPG 115 WP+EL PG Sbjct: 178 WPEELEPG 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,505 Number of Sequences: 438 Number of extensions: 2788 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -