BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0629 (928 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29370.1 68414.m03591 kinase-related similar to putative prot... 29 3.3 >At1g29370.1 68414.m03591 kinase-related similar to putative protein kinase (GI:11125348) [Homo sapiens]; similar to Paired box protein Pax-8 (Swiss-Prot:P47240) [Canis familiaris] Length = 831 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/69 (24%), Positives = 29/69 (42%) Frame = -3 Query: 218 TASNHFEGHRNSSRSLFLVDCSSSSMRGIGYASPFVTALSRR*STQNLYPPLAFGTRTVG 39 T S +F+G + + +SS G A+ + T S +T+N PP+ G Sbjct: 114 TDSGNFQGKSTNKKESGTQGYTSSWSSASGVANTYQTPHSEPVATENKLPPVTLGDGISS 173 Query: 38 ADQADSHSS 12 + A H + Sbjct: 174 SQSASGHQT 182 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,346,153 Number of Sequences: 28952 Number of extensions: 404511 Number of successful extensions: 1061 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1061 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2207676696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -