Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbpv0629
         (928 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g29370.1 68414.m03591 kinase-related similar to putative prot...    29   3.3  

>At1g29370.1 68414.m03591 kinase-related similar to putative protein
           kinase (GI:11125348) [Homo sapiens]; similar to Paired
           box protein Pax-8 (Swiss-Prot:P47240) [Canis familiaris]
          Length = 831

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = -3

Query: 218 TASNHFEGHRNSSRSLFLVDCSSSSMRGIGYASPFVTALSRR*STQNLYPPLAFGTRTVG 39
           T S +F+G   + +       +SS     G A+ + T  S   +T+N  PP+  G     
Sbjct: 114 TDSGNFQGKSTNKKESGTQGYTSSWSSASGVANTYQTPHSEPVATENKLPPVTLGDGISS 173

Query: 38  ADQADSHSS 12
           +  A  H +
Sbjct: 174 SQSASGHQT 182


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,346,153
Number of Sequences: 28952
Number of extensions: 404511
Number of successful extensions: 1061
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 987
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1061
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2207676696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)