BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0627 (731 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118595-1|AAM49964.1| 647|Drosophila melanogaster LD47639p pro... 40 0.003 AE013599-2163|AAF58074.2| 647|Drosophila melanogaster CG8399-PA... 40 0.003 AY113534-1|AAM29539.1| 159|Drosophila melanogaster RE60882p pro... 33 0.30 AY071565-1|AAL49187.1| 159|Drosophila melanogaster RE63144p pro... 33 0.30 AE014134-2485|AAF53387.1| 159|Drosophila melanogaster CG7532-PA... 33 0.30 >AY118595-1|AAM49964.1| 647|Drosophila melanogaster LD47639p protein. Length = 647 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -3 Query: 246 PQGLTGEVVFRATIVKTLKVFWVGVQSAPIKIV 148 P G+VVF ATI ++ FWVGV S P++IV Sbjct: 148 PVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIV 180 >AE013599-2163|AAF58074.2| 647|Drosophila melanogaster CG8399-PA protein. Length = 647 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -3 Query: 246 PQGLTGEVVFRATIVKTLKVFWVGVQSAPIKIV 148 P G+VVF ATI ++ FWVGV S P++IV Sbjct: 148 PVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIV 180 >AY113534-1|AAM29539.1| 159|Drosophila melanogaster RE60882p protein. Length = 159 Score = 33.5 bits (73), Expect = 0.30 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 249 PPQGLTGEVVFRATIVKTLKVFWVG 175 PP G G V F AT+V+T V+WVG Sbjct: 126 PPAGYKGNVKFMATVVQTGFVYWVG 150 >AY071565-1|AAL49187.1| 159|Drosophila melanogaster RE63144p protein. Length = 159 Score = 33.5 bits (73), Expect = 0.30 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 249 PPQGLTGEVVFRATIVKTLKVFWVG 175 PP G G V F AT+V+T V+WVG Sbjct: 126 PPAGYKGNVKFMATVVQTGFVYWVG 150 >AE014134-2485|AAF53387.1| 159|Drosophila melanogaster CG7532-PA protein. Length = 159 Score = 33.5 bits (73), Expect = 0.30 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 249 PPQGLTGEVVFRATIVKTLKVFWVG 175 PP G G V F AT+V+T V+WVG Sbjct: 126 PPAGYKGNVKFMATVVQTGFVYWVG 150 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,465,939 Number of Sequences: 53049 Number of extensions: 628960 Number of successful extensions: 1225 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1225 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3293648160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -