BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0626 (377 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 3.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 4.1 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 5.4 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 20 7.2 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 20 9.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 20 9.5 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 3.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 33 LRSLHQRHSHA*GQPPSVGS 92 LRS HQ+ SH G+ GS Sbjct: 789 LRSYHQQQSHHYGRRERSGS 808 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 4.1 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +1 Query: 7 RHEVLAPVLYALYTNDIPTLEGNLQAW 87 RHEV P A N P + Q W Sbjct: 338 RHEVTRPAAPANRGNGFPKRSSDEQQW 364 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 20.6 bits (41), Expect = 5.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +3 Query: 21 GTSPLRSLHQRHSHA*GQPP 80 G SP S H H +PP Sbjct: 44 GMSPYASSQHHHHHLQARPP 63 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 20.2 bits (40), Expect = 7.2 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +1 Query: 37 ALYTNDIPTLEGNLQAWEADVKL 105 A+Y+N +P N +WE+ +++ Sbjct: 89 AIYSNLLPRPGSNDNSWESLIEV 111 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 19.8 bits (39), Expect = 9.5 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +2 Query: 20 WHQSSTLSTPTTFPRLRATSKRG 88 WH + + S P P+L +K G Sbjct: 251 WHITDSQSFPLELPQLPNMTKFG 273 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 19.8 bits (39), Expect = 9.5 Identities = 8/31 (25%), Positives = 11/31 (35%) Frame = +2 Query: 266 PHKSRPXXXXXXXELMXSLGPVSDTWESIST 358 PH P + GP TW ++ T Sbjct: 282 PHVYNPPDHIQQATPYSAPGPTYSTWSTVQT 312 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,318 Number of Sequences: 336 Number of extensions: 1002 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 7803226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -