BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0625 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharom... 29 0.53 SPBC215.01 ||SPBC3B9.20|GTPase activating protein|Schizosaccharo... 27 3.7 >SPAC23D3.10c |eng2||endo-1,3-beta-glucanase Eng2|Schizosaccharomyces pombe|chr 1|||Manual Length = 706 Score = 29.5 bits (63), Expect = 0.53 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 224 KYKKQSTNKKYWQLNSF*TQKSGFSNITRAINPQ 325 KY+ Q T+ K W L +F T S N+T A N Q Sbjct: 182 KYRIQLTDGKIWFLYAFPTSSSSTFNLTLASNSQ 215 >SPBC215.01 ||SPBC3B9.20|GTPase activating protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 834 Score = 26.6 bits (56), Expect = 3.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 484 VYNNGHEVIIVKHKIFLGSS 425 +Y+ HEV+ KH++ LGSS Sbjct: 526 IYDRYHEVLSSKHRVGLGSS 545 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,765,908 Number of Sequences: 5004 Number of extensions: 53251 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -