BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0624 (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 0.98 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 0.98 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 0.98 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 0.98 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 9.1 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.98 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 104 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 6 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 376 LIFGTSQNGPE*VLLICN 429 L+F TSQ P+ V + CN Sbjct: 93 LLFMTSQLKPDKVTVFCN 110 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.98 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 104 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 6 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 376 LIFGTSQNGPE*VLLICN 429 L+F TSQ P+ V + CN Sbjct: 93 LLFMTSQLKPDKVTVFCN 110 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.98 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 104 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 6 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 376 LIFGTSQNGPE*VLLICN 429 L+F TSQ P+ V + CN Sbjct: 93 LLFMTSQLKPDKVTVFCN 110 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.98 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 104 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 6 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 376 LIFGTSQNGPE*VLLICN 429 L+F TSQ P+ V + CN Sbjct: 93 LLFMTSQLKPDKVTVFCN 110 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -3 Query: 449 KVTMVIKLQINSTYSGPFCDVPKINIALIFLFIFGKYFSKLNL 321 K +V + I ST+S F DV + + F+F + +K+ + Sbjct: 87 KAILVHAITIRSTFSWTFIDVFIMLTSTAFVFRLKQLNAKVEM 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,526 Number of Sequences: 336 Number of extensions: 3135 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -