BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0624 (670 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|... 29 0.61 SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schi... 26 5.6 >SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 732 Score = 29.1 bits (62), Expect = 0.61 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 154 NYLSKEICFAMRVRILLLLKYFDKFAVVFYVSI 252 NY++ IC + IL+LL YF VFY S+ Sbjct: 162 NYIAFPICLFVINHILILLGYFQCSYSVFYASV 194 >SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 766 Score = 25.8 bits (54), Expect = 5.6 Identities = 16/69 (23%), Positives = 34/69 (49%) Frame = +1 Query: 457 FPNQLKE*REHSLLIDINSYNKYVRQLIRTVRV*NITAIIRLYRRNVEENXRQFNDIMIL 636 FP+ K +L + S Y+ L+R V++ N+ A++++ N+ N + + +L Sbjct: 113 FPDDRKLQLYGALFFLLQSEPAYIASLVRRVKLFNMDALLQIVMFNIYGNQYESREEHLL 172 Query: 637 FAXKKNHLT 663 + + LT Sbjct: 173 LSLFQMVLT 181 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,512,923 Number of Sequences: 5004 Number of extensions: 49848 Number of successful extensions: 97 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -