BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0622 (853 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 27 0.55 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 26 1.3 DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary ... 24 6.7 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 23 8.9 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 8.9 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 27.5 bits (58), Expect = 0.55 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 398 MRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIV 508 +RT LRGH + + + W + L S G + V Sbjct: 54 LRTNYNLRGHRSDVILVKWNEPYQKLASCDSSGIIFV 90 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 26.2 bits (55), Expect = 1.3 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 417 CAVISRRSTPCTGAAIPGTWCRP 485 CA ++ PCT I G +C+P Sbjct: 52 CADLNELQKPCTKQCIQGCFCKP 74 >DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 99 Score = 23.8 bits (49), Expect = 6.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 447 CTGAAIPGTWCRP 485 CTG + G +CRP Sbjct: 52 CTGVCVSGCFCRP 64 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 23.4 bits (48), Expect = 8.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 289 PGGGNP*KRY*RCEKSGMRHVAGPGHLE 372 PG GN K Y R K R + G G L+ Sbjct: 116 PGSGNIPKNYARLLKEFTRDIGGKGILK 143 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 8.9 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -1 Query: 502 QLTILTGRHQVPGIAAPVHGVDLREMTAQGSSGAHLYATD 383 ++ +L P + PV+ +D+ E G+ L ATD Sbjct: 501 RVVVLDQNDNFPEFSQPVYDIDVPENVIAGTVLLQLQATD 540 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 861,094 Number of Sequences: 2352 Number of extensions: 18115 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90545769 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -