BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0621 (718 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62360.1 68416.m07005 expressed protein 31 0.76 At3g59760.2 68416.m06668 cysteine synthase, mitochondrial, putat... 27 9.4 >At3g62360.1 68416.m07005 expressed protein Length = 1227 Score = 31.1 bits (67), Expect = 0.76 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +1 Query: 319 GSATSAAFKVKKGGRYQMQVELCNSDGCSSSEGVEIVVADTDGSHL 456 G+ + +K GG + VEL +SDG S + V V+ +DGS+L Sbjct: 138 GAVGGESCLIKNGGPADVNVELLSSDG--SEDPVASVLTSSDGSYL 181 >At3g59760.2 68416.m06668 cysteine synthase, mitochondrial, putative / O-acetylserine (thiol)-lyase, putative / O-acetylserine sulfhydrylase, putative similar to SP|Q43725 Cysteine synthase, mitochondrial precursor (EC 4.2.99.8) (O- acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) {Arabidopsis thaliana} Length = 432 Score = 27.5 bits (58), Expect = 9.4 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = -2 Query: 663 NFFQTVIDAITTTNRNEAVEQMSQVSEPER---GPQGTF*DTHPIRRSKRPPLFPSLLEG 493 N Q ++D + + EA+E Q++ E G I+ +KRP L+ Sbjct: 342 NLDQKIMDEVIAISSEEAIETAKQLALKEGLMVGISSGAAAAAAIKVAKRPENAGKLIAV 401 Query: 492 LIFLTNRIIERPQMATIS 439 +F + R I RP+ +++S Sbjct: 402 SLFASGRDIYRPRCSSLS 419 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.134 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,675,226 Number of Sequences: 28952 Number of extensions: 298990 Number of successful extensions: 800 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -