BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0620 (862 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20347| Best HMM Match : Peptidase_A17 (HMM E-Value=1.9e-20) 29 3.7 >SB_20347| Best HMM Match : Peptidase_A17 (HMM E-Value=1.9e-20) Length = 1074 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 252 LENRPRTYTNTCPGQGLL---HCLMYQMIENCPEESLRKDDVCSPVSSLSGFNYMFSQSM 422 L +RP TY G+ L H + + + + P+E + DDV +P + S F Y +S+ Sbjct: 889 LNDRPLTYVYDEVGEVELTPAHLMYGRRLNSFPDEVVEPDDVANPDHN-SRFRYRWSKEY 947 Query: 423 YEDLEE 440 L E Sbjct: 948 LASLRE 953 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,655,905 Number of Sequences: 59808 Number of extensions: 670040 Number of successful extensions: 1605 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1603 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -