BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0620 (862 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT004480-1|AAO42644.1| 787|Drosophila melanogaster LD47550p pro... 31 2.7 AE013599-943|AAF58888.1| 787|Drosophila melanogaster CG1671-PA ... 31 2.7 AY118371-1|AAM48400.1| 676|Drosophila melanogaster RE13854p pro... 30 3.6 AE014298-2438|AAF48635.1| 676|Drosophila melanogaster CG4521-PA... 30 3.6 >BT004480-1|AAO42644.1| 787|Drosophila melanogaster LD47550p protein. Length = 787 Score = 30.7 bits (66), Expect = 2.7 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 251 HTSRIWSVRFRQAPSGNILLKTTADCSL 168 HT +WSVRF +P I+L +++DC+L Sbjct: 519 HTRGVWSVRF--SPVDQIVLTSSSDCTL 544 >AE013599-943|AAF58888.1| 787|Drosophila melanogaster CG1671-PA protein. Length = 787 Score = 30.7 bits (66), Expect = 2.7 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 251 HTSRIWSVRFRQAPSGNILLKTTADCSL 168 HT +WSVRF +P I+L +++DC+L Sbjct: 519 HTRGVWSVRF--SPVDQIVLTSSSDCTL 544 >AY118371-1|AAM48400.1| 676|Drosophila melanogaster RE13854p protein. Length = 676 Score = 30.3 bits (65), Expect = 3.6 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = +1 Query: 64 LVQAEFGTPYLRKSRLCHQWSCINTKLGFPESLPPREQSAV----VLSRILPDGAWR 222 LVQ E LR S+ C +W NT+L + L P Q+AV LS LP+G+++ Sbjct: 183 LVQQEPPKASLRLSKCCGKWGSYNTQLQNCD-LQPNHQAAVDGLLRLSPQLPEGSYQ 238 >AE014298-2438|AAF48635.1| 676|Drosophila melanogaster CG4521-PA protein. Length = 676 Score = 30.3 bits (65), Expect = 3.6 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = +1 Query: 64 LVQAEFGTPYLRKSRLCHQWSCINTKLGFPESLPPREQSAV----VLSRILPDGAWR 222 LVQ E LR S+ C +W NT+L + L P Q+AV LS LP+G+++ Sbjct: 183 LVQQEPPKASLRLSKCCGKWGSYNTQLQNCD-LQPNHQAAVDGLLRLSPQLPEGSYQ 238 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,917,122 Number of Sequences: 53049 Number of extensions: 980712 Number of successful extensions: 2977 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2977 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4147514904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -