BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0620 (862 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05880.1 68414.m00616 expressed protein 30 1.7 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 29 4.0 At5g07220.1 68418.m00823 BAG domain-containing protein contains ... 28 7.0 At5g19020.1 68418.m02260 pentatricopeptide (PPR) repeat-containi... 28 9.2 At2g41520.2 68415.m05131 DNAJ heat shock N-terminal domain-conta... 28 9.2 At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-conta... 28 9.2 >At1g05880.1 68414.m00616 expressed protein Length = 426 Score = 30.3 bits (65), Expect = 1.7 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 373 HPCRHFLDSITCSHKVCTKIWRS 441 HP ++ L S++C H++CT+ W S Sbjct: 101 HPHKN-LASVSCGHRICTRCWTS 122 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = -3 Query: 272 CTRPIL*HTSRIWSVRFRQAPSGNILLKTTADCSL 168 C P++ H S +WS+ + + G++L +ADC++ Sbjct: 575 CITPLMGHNSCVWSLSY--SGEGSLLASGSADCTV 607 >At5g07220.1 68418.m00823 BAG domain-containing protein contains Pfam:PF02179 BAG domain Length = 303 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -2 Query: 342 PDNSQSSDTSGSAADPVRDTCWCMYEAYSLAHIQDMVSQIPP 217 P NS +S +SG+ A V + W M+++ S A + V +PP Sbjct: 256 PRNSNASSSSGTPA--VVASKWEMFDSASTAKAAETVKPVPP 295 >At5g19020.1 68418.m02260 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 939 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 8 MFFSKTWVCSGYFSYLIWHWCKLSSAH 88 + FS T++ S YFSYLI H L S+H Sbjct: 59 VLFSGTFLLSSYFSYLI-HSLSLLSSH 84 >At2g41520.2 68415.m05131 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1077 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 35 SGYFSYLIWHWCKLSSAHLT*ENLD 109 S Y S ++W W K+S +H NL+ Sbjct: 771 STYHSLIVWRWNKISKSHFYLGNLE 795 >At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1108 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 35 SGYFSYLIWHWCKLSSAHLT*ENLD 109 S Y S ++W W K+S +H NL+ Sbjct: 771 STYHSLIVWRWNKISKSHFYLGNLE 795 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,436,738 Number of Sequences: 28952 Number of extensions: 453501 Number of successful extensions: 1064 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1064 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -