BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0615 (798 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7I7W5 Cluster: Putative uncharacterized protein precur... 34 4.8 >UniRef50_A7I7W5 Cluster: Putative uncharacterized protein precursor; n=1; Candidatus Methanoregula boonei 6A8|Rep: Putative uncharacterized protein precursor - Methanoregula boonei (strain 6A8) Length = 361 Score = 33.9 bits (74), Expect = 4.8 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +3 Query: 513 TPIKANTTNTHTVHKQTLGTRLVAPGSXFASATQRHPYDDGGYAVVMDS 659 T I N NT++ Q+ T +APG F +HP ++G + +V DS Sbjct: 77 TTIPVNDDNTYSYQLQSADTANLAPGQYFVIV--QHPMENGRFDIVYDS 123 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,035,249 Number of Sequences: 1657284 Number of extensions: 12935524 Number of successful extensions: 26909 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 26104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26900 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68319938570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -