BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0615 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 25 2.0 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 8.3 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 23 8.3 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 25.4 bits (53), Expect = 2.0 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 612 GWRWRTVTLARPTACQVFVYEQCECSWYWL-LLVCVS 505 GWR A AC+VF++ + C + +LVCVS Sbjct: 136 GWRITVQWHAGNVACKVFLFMRAFCLYLSSNVLVCVS 172 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/43 (23%), Positives = 17/43 (39%) Frame = +2 Query: 380 CN*QNCILEINHHHY*AISVHCWIQATNNKTMEQ*LAFNCTLD 508 C +C H HY ++ CW T + + + CT + Sbjct: 17 CEPPDCADTAIHAHYCQNAIQCWKSRTRDPEGNENVQRGCTTE 59 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 59 IIYMCRVPTPPLHS 18 I MC P PPLH+ Sbjct: 330 IAQMCAAPPPPLHA 343 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 737,734 Number of Sequences: 2352 Number of extensions: 15631 Number of successful extensions: 56 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -