BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0615 (798 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01980.1 68415.m00133 sodium proton exchanger, putative (NHX7... 28 8.3 >At2g01980.1 68415.m00133 sodium proton exchanger, putative (NHX7) (SOS1) identical to putative Na+/H+ antiporter SOS1 [Arabidopsis thaliana] gi|8515714|gb|AAF76139; Member of The Monovalent Cation:Proton Antiporter (CPA1) Family, PMID:11500563 Length = 1146 Score = 27.9 bits (59), Expect = 8.3 Identities = 21/91 (23%), Positives = 47/91 (51%), Gaps = 2/91 (2%) Frame = +3 Query: 297 VCISNRILNINHTAYRIRLNLFQHMYYIVI--SKTVFLK*IIIIIRLYQSTVGYRLRIIK 470 V I+ IL+ + AY+ F + Y+ I S+ V + + ++ + + ++ II Sbjct: 332 VVIAEGILDSDKIAYQGNSWRFLFLLYVYIQLSRVVVVGVLYPLLCRFGYGLDWKESIIL 391 Query: 471 LWNSNSPSIAL*IRTPIKANTTNTHTVHKQT 563 +W+ ++AL + +K ++ N+H + K+T Sbjct: 392 VWSGLRGAVALALSLSVKQSSGNSH-ISKET 421 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,733,754 Number of Sequences: 28952 Number of extensions: 283513 Number of successful extensions: 502 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -