BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0613 (858 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 1.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 1.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 1.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 1.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 1.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 25 1.0 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 1.0 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 25 1.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 1.0 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 4.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.4 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 9.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.4 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 80 RSTPPLSTPSNSNATKSSGL 99 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 402 RVTPPMSMFSTASATVTSGL 343 R TPP+S S ++AT +SGL Sbjct: 124 RSTPPLSTPSNSNATKSSGL 143 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 680 LVVKNLGPASDVGSYRIL 627 + +K++GP+S V YR L Sbjct: 252 MALKHVGPSSQVADYRSL 269 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.4 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 559 TMTSPYRTTFRKQYSXGASPTDLKIRYEPTSEAGPRFFTT 678 T TSP+ TT + + PT PT+ P TT Sbjct: 1046 TTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTT 1085 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.4 bits (43), Expect = 9.4 Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = -1 Query: 339 TVW---TNGYRLQTTTLIISYF*RFMSSWSEWIIELRSQHVPLDVKFSPDLRASPV 181 TVW YRL ++ S+ F S+W ++ + + + P + P+ Sbjct: 21 TVWHVENPTYRLYKIFVVFSFAVTFFSAWICALVNYNVSEISENFYYLPAMSTGPL 76 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 390 PMSMFSTASATVTSGLDTVWTN 325 P++ S ASA S LD W + Sbjct: 359 PLTSLSLASAQTLSELDLSWNS 380 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,773 Number of Sequences: 336 Number of extensions: 3386 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -