BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0612 (557 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces... 25 7.5 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 25 10.0 >SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 25.0 bits (52), Expect = 7.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 320 GLDWGWFCFCTFVLCL 273 GL WGW F++C+ Sbjct: 94 GLLWGWLIAMVFIICI 109 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 24.6 bits (51), Expect = 10.0 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +3 Query: 60 YYLLDSKTLIKSLKNGCK*YELRYKSLYGLKYVLTKFENWT 182 YYL ++ KSL G K L + + + T+F++W+ Sbjct: 1099 YYLFFNRNREKSLTKGIKRLSLSSQPTFVTESNTTEFDDWS 1139 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,819,172 Number of Sequences: 5004 Number of extensions: 28495 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -