BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0612 (557 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) 27 7.9 >SB_26523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 268 LQRHRTKVQKQNHPQSKPQADYXXXXXXXXXXWADMLDEGEQ 393 + R RTK+ Q H + AD WADM+D+G + Sbjct: 5 INRSRTKMLDQGHQIIQGWADMVDQGRRIIQGWADMVDQGRR 46 >SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 202 QNK*SQEXQSHH*QDEKTGQLKLQRHRTKVQKQNHPQSKPQ 324 Q + Q+ Q H Q ++ + Q+H + Q+Q+H Q KPQ Sbjct: 1107 QQQHDQQQQQRHDQQQQHHDQQQQQHHDQ-QQQHHEQQKPQ 1146 >SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) Length = 3342 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 199 NQNK*SQEXQSHH*QDEKTGQL--KLQRHRTKVQKQNHPQSKPQADY 333 N NK E Q HH Q ++ + QRH+ H Q K Q Y Sbjct: 854 NMNKPINEKQRHHQQGKQQHHRLHQQQRHKKNDNPHQHQQQKQQHGY 900 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,036,465 Number of Sequences: 59808 Number of extensions: 197906 Number of successful extensions: 407 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -