BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0612 (557 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83233-8|CAB05759.2| 378|Caenorhabditis elegans Hypothetical pr... 29 3.0 U21308-12|AAB93315.2| 360|Caenorhabditis elegans Hypothetical p... 27 9.1 >Z83233-8|CAB05759.2| 378|Caenorhabditis elegans Hypothetical protein K06B4.8 protein. Length = 378 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +3 Query: 9 ILKE-SIKLNQNLLKFITYYLLDSKTLIKSLKN 104 +LKE +IK +N KFI YY + +L+ LKN Sbjct: 107 LLKELTIKDGKNYTKFINYYSNEDPSLVDVLKN 139 >U21308-12|AAB93315.2| 360|Caenorhabditis elegans Hypothetical protein ZK1290.9 protein. Length = 360 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 12 LKESIKLNQNLLKF-ITYYLLDSKTLIKSLKNGCK*YELRYKSLYGLKYVLTKFEN 176 + +I+ N+ L++ I Y LD K + +S KN C+ +L+ Y +F N Sbjct: 1 MSAAIRENELLIRACILYESLDDKPIAESYKNFCRKVGKDIMTLHDFDYWFYRFHN 56 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,876,264 Number of Sequences: 27780 Number of extensions: 157040 Number of successful extensions: 288 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 288 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -