BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0611 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 27 3.1 SPBC83.09c |||GYF domain|Schizosaccharomyces pombe|chr 2|||Manual 26 4.1 SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom... 26 4.1 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 26 5.4 SPBC2A9.03 |||conserved protein |Schizosaccharomyces pombe|chr 2... 25 7.2 SPBP8B7.19 |spt16||FACT complex component Spt16|Schizosaccharomy... 25 9.5 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 26.6 bits (56), Expect = 3.1 Identities = 20/62 (32%), Positives = 28/62 (45%) Frame = +3 Query: 252 MSTPTSSGCKAPRTSSGIVSRLSSHLS*LKTMLSLCTGETVSLLH*ATMAGLPTGTAKTG 431 +STP S+ P + S SRLSS L+ S+ ET + PTG++ G Sbjct: 729 VSTPLSNSSAYPSSGSSTFSRLSSTLT-----SSIIPTETFGSTSGSATGTRPTGSSSQG 783 Query: 432 PV 437 V Sbjct: 784 SV 785 >SPBC83.09c |||GYF domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 408 Score = 26.2 bits (55), Expect = 4.1 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 144 DYDSAVERSKLIYTDNKGELITNVVNNLIRNNKMNCMSTPTS 269 D D + SKL Y D +G+ TN N+L + + + +S P+S Sbjct: 115 DEDDNGKYSKLRYEDIEGQEDTNQANDLDADEEGSEISVPSS 156 >SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1158 Score = 26.2 bits (55), Expect = 4.1 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 242 DELHEYAYQLWMQGSEDIVRDCFPVEFTLILAENYVKLMYRRDGLAFTLSD 394 DE+ EY Y+ M + + CF LILA +K+ + +A +L D Sbjct: 997 DEISEYLYRRLMDEESSVKKTCFMTLAFLILA-GQIKVKGQLGIMARSLED 1046 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -2 Query: 328 KCELNRETIPDDVLGALHPELVGVLMQFIL 239 K +L +E +P+DVL A P+ V+ Q+I+ Sbjct: 1080 KADLEKE-LPEDVLNAEFPDGTDVITQYIV 1108 >SPBC2A9.03 |||conserved protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +3 Query: 186 DNKGELITNVVNNLIRNNKMNCMSTPTSSGC 278 DN ++I ++ NN+++ ++C+ T + GC Sbjct: 165 DNSVQII-DLKNNILQKKAISCLDTTNAVGC 194 >SPBP8B7.19 |spt16||FACT complex component Spt16|Schizosaccharomyces pombe|chr 2|||Manual Length = 1019 Score = 25.0 bits (52), Expect = 9.5 Identities = 26/103 (25%), Positives = 41/103 (39%), Gaps = 4/103 (3%) Frame = +3 Query: 144 DYDSAVERSKLIYTDNKGELITN--VVNNLIRNNKMNCMSTPTSSGCK--APRTSSGIVS 311 ++ +E+ KLI NK N V I ++ +G + +P S + Sbjct: 642 EFADVIEQDKLIEIKNKRPAHINDVYVRPAIDGKRLPGFIEIHQNGIRYQSPLRSDSHID 701 Query: 312 RLSSHLS*LKTMLSLCTGETVSLLH*ATMAGLPTGTAKTGPVQ 440 L S++ L C GE + L+H A + G KT VQ Sbjct: 702 LLFSNMKHL--FFQPCEGELIVLIHVHLKAPIMVGKRKTQDVQ 742 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,373,799 Number of Sequences: 5004 Number of extensions: 44725 Number of successful extensions: 127 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -