BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0611 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF... 28 6.2 At2g29060.1 68415.m03532 scarecrow transcription factor family p... 27 8.2 >At1g67490.1 68414.m07686 alpha-glucosidase I (GCS1) / KNOPF (KNF) identical to alpha-glucosidase I (GI:16506680, GI:13398928) [Arabidopsis thaliana] Length = 852 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 162 ERSKLIYTDNKGELITNVVNN 224 E+SK IYT+ + LI NVV N Sbjct: 790 EKSKAIYTELRSNLIRNVVRN 810 >At2g29060.1 68415.m03532 scarecrow transcription factor family protein Length = 1336 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 374 LAFTLSDNGGVAYGDSKDRTSSRVSWKFIPLWENNK 481 LA +S GG +Y S TSS W F L ENN+ Sbjct: 116 LAQLVSSPGGSSYASSTTTTSSDSQWSFDCL-ENNR 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,533,942 Number of Sequences: 28952 Number of extensions: 237916 Number of successful extensions: 674 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -