BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0603 (941 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical pr... 30 2.8 Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 4.8 AC006638-8|AAK85487.2| 644|Caenorhabditis elegans Hypothetical ... 28 8.4 >Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical protein B0334.5 protein. Length = 500 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = +2 Query: 95 VFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIEKSCDKYMNAMSLSSS 274 +F K+ V M+ + ++ HI QP ++ I N+E + S +S Sbjct: 68 LFIKKDQVTPRPIMRRSTQLSIIHHIRQPCQ-SNVPRICDAPNLETTATSTTKLFSWNSQ 126 Query: 275 WRCIR 289 W C+R Sbjct: 127 WTCLR 131 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 411 RSPHENIEVLSVVEDSEDFD 352 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 >AC006638-8|AAK85487.2| 644|Caenorhabditis elegans Hypothetical protein F41G4.7 protein. Length = 644 Score = 28.3 bits (60), Expect = 8.4 Identities = 22/79 (27%), Positives = 32/79 (40%) Frame = +1 Query: 178 ADHV*GHQGDRQGV*HREKLRQVHECDVVKQFMEMYKMGMLPRGETFVHTNELQMEEAVK 357 AD DR+ HRE R++HE F + + LP TF + E + Sbjct: 57 ADDEQRQSADRRAQDHRESFRRLHE--EASSFADFFTNARLPAMRTF--SPEAARSSSNS 112 Query: 358 VFRVLYYAKDFDVFMRTAC 414 R +DF++ M AC Sbjct: 113 SDRNPRMDQDFELAMELAC 131 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,971,041 Number of Sequences: 27780 Number of extensions: 369549 Number of successful extensions: 877 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 877 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2433684176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -