BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0603 (941 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27110.2 68415.m03258 far-red impaired responsive protein, pu... 29 4.5 At2g27110.1 68415.m03257 far-red impaired responsive protein, pu... 29 4.5 At5g18580.1 68418.m02196 tonneau 2 (TON2) identical to tonneau 2... 29 5.9 At3g60800.1 68416.m06801 zinc finger (DHHC type) family protein ... 28 7.8 >At2g27110.2 68415.m03258 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 310 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 435 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At2g27110.1 68415.m03257 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 310 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 435 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At5g18580.1 68418.m02196 tonneau 2 (TON2) identical to tonneau 2 protein (TON2) GI:11494362 from [Arabidopsis thaliana]; contains Pfam profile: PF00036 EF hand Length = 480 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 197 IKEIAKEYNIEKSCDKYMNAMSLSSSWRCIRWAC 298 ++++AK ++K D +NA L++ W C+R C Sbjct: 89 VQKLAKYRFLKKQSDLLLNADDLAAMWVCLRENC 122 >At3g60800.1 68416.m06801 zinc finger (DHHC type) family protein contains DHHC zinc finger domain PF01529 Length = 307 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +2 Query: 599 VLWKYYGITVTDDNLVVIDWRKGVRRSLSQNDVMS 703 +LW Y+ + TD +V +WR ++D ++ Sbjct: 74 LLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLN 108 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,328,986 Number of Sequences: 28952 Number of extensions: 354665 Number of successful extensions: 913 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2256303936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -