BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0602 (807 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 27 0.13 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 27 0.23 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 27 0.23 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 5.0 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 27.5 bits (58), Expect = 0.13 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 25 YQKLITAVTSLVQFLRTQLNEFGIINTTPDFANFFAAPSSIK 150 +QKL + ++ L Q FG++ TPD + F PSS++ Sbjct: 4 FQKLYQKFVNSIRILLFQSRIFGLVTFTPDRSKF--RPSSLR 43 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 26.6 bits (56), Expect = 0.23 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 544 HXLFDDRESFGSPFRIACPFSFNSMIVRSYL 452 H ++ ESF SP++ +C F +++ RS L Sbjct: 376 HDIWMSGESFKSPYKASCWAQFKAVLWRSIL 406 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 26.6 bits (56), Expect = 0.23 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 544 HXLFDDRESFGSPFRIACPFSFNSMIVRSYL 452 H ++ ESF SP++ +C F +++ RS L Sbjct: 376 HDIWMSGESFKSPYKASCWAQFKAVLWRSIL 406 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 419 FKTENPRLLFWKIR 460 +K ENP + W+IR Sbjct: 124 YKRENPSIFSWEIR 137 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,172 Number of Sequences: 336 Number of extensions: 3004 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -