BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0602 (807 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 1.1 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 2.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.4 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 5.8 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 5.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/51 (25%), Positives = 21/51 (41%) Frame = +3 Query: 510 LPKDSRSSKRXCSLSVNQATXSVLAHCTVSWSFCTSKLEVCYIEANGFYLG 662 L D S + C Q + ++L + T VC +A+GF+ G Sbjct: 30 LDNDKEQSAQVCYRGAPQDSENLLGRVLAEFDGTTVLCRVCGDKASGFHYG 80 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +1 Query: 202 YSGDFPXILALLRAYRPRASTH*TKCPSKLRAVVVNGQH 318 Y+ D+P + ++ + PR + + PS +R + G H Sbjct: 138 YNFDYPQVPYTVKNFHPRCAVNNYNDPSNVRNCELVGLH 176 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 97 INTTPDFANFFAAPSSIKSA 156 +N PD N +A P+ KSA Sbjct: 1467 LNHYPDLHNLYAVPTDKKSA 1486 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 573 SVLAHCTVSWSFCTSK 620 S++ +C V W F TSK Sbjct: 71 SLVGNCCVIWIFSTSK 86 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 573 SVLAHCTVSWSFCTSK 620 S++ +C V W F TSK Sbjct: 71 SLVGNCCVIWIFSTSK 86 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,757 Number of Sequences: 438 Number of extensions: 4151 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -