BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0596 (727 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033558-1|AAH33558.1| 195|Homo sapiens LASS5 protein protein. 32 2.4 AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ... 31 5.6 >BC033558-1|AAH33558.1| 195|Homo sapiens LASS5 protein protein. Length = 195 Score = 31.9 bits (69), Expect = 2.4 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -1 Query: 727 RNAGSPTICPQTCQ-YHXGCGAPDSAAXKCNYELFNRNNFSIRYWSW 590 RN P + C+ H G G DSA ++ LF +I W+W Sbjct: 130 RNQDKPPTLTKFCESIHLGSGTSDSAGITIHFSLFQVGFITIISWNW 176 >AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor marker CA125 protein. Length = 22152 Score = 30.7 bits (66), Expect = 5.6 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -3 Query: 500 KSPVSLFFVTT---SRAGSG*FARLLPXLDVVAVSQAPSPESNPDSPLPVTTMVVA 342 ++P + ++TT SG F+ + P + + + SPES P SPLPVT ++ + Sbjct: 5614 RTPGDVSWMTTPPVEETSSG-FSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,043,082 Number of Sequences: 237096 Number of extensions: 2118466 Number of successful extensions: 5497 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5497 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8567175942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -