BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0593 (992 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 30 0.024 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 30 0.024 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 8.5 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 30.3 bits (65), Expect = 0.024 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 394 EFKYKMEMEIKDE-NLRNSVPFVRQLSTDSVKTKTEYDNGMEHRTNLQL 537 E K+ M+ IK+ L SVPF+ ++S ++TKT Y + NLQ+ Sbjct: 344 ELKF-MDRVIKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMVNLQI 391 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 30.3 bits (65), Expect = 0.024 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 394 EFKYKMEMEIKDE-NLRNSVPFVRQLSTDSVKTKTEYDNGMEHRTNLQL 537 E K+ M+ IK+ L SVPF+ ++S ++TKT Y + NLQ+ Sbjct: 344 ELKF-MDRVIKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMVNLQI 391 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.4 bits (48), Expect = 2.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 375 SDQFRKRIQIQNGNGNQG 428 SD K ++ NGNG +G Sbjct: 387 SDHLAKHVKTHNGNGKKG 404 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 8.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 169 SWSQIRPGAFETNALSVN 222 SWSQ RPGA + +N Sbjct: 530 SWSQKRPGAGKFTPEDIN 547 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,759 Number of Sequences: 336 Number of extensions: 5268 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28237209 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -