BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0588 (523 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 3.6 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 4.7 AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding pr... 23 8.2 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.8 bits (49), Expect = 3.6 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +2 Query: 341 ILAENYVKLMYRRDGLAFTLSDNGGVAYGD--SKDRTSSRVSWKFIPLWENNKVYFKIR 511 +LA + +L+ + L T+SD GD SK+R + I + E K ++R Sbjct: 290 VLATEHQQLLREKTKLDLTISDLSDEVQGDNKSKERAEQELERLKITIAEKEKELEQVR 348 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 107 LQRNPGGDLYNDVIIADYDSAVERSKLIY 193 LQ+ G L+ DV+IAD+ ++ +++ Sbjct: 276 LQQYGCGGLFVDVLIADFSRSIWADSIVF 304 >AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding protein AgamOBP36 protein. Length = 277 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -3 Query: 320 NNPRTMSSEPCIQSW*AYSMQF 255 N P+ + EPC+Q++ A+ + Sbjct: 113 NLPQECNGEPCVQAYRAFQCYY 134 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,224 Number of Sequences: 2352 Number of extensions: 9258 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -