BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0586 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 6.0 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 6.0 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 6.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.0 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 8.0 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 265 EYAYQLWMQGSEDIVRGLFPG*VHTYLS 348 +Y Q+W GS+ VR L LS Sbjct: 440 KYIIQIWTTGSDPQVRNLLDNGYRVILS 467 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 6.0 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +1 Query: 412 RGCLRGQQRQDQFKSQLEIHSAVGEQQGLLQDKNTERKQNLALKVRTN 555 R C + R K+ L HS + + +K+ + NL VRT+ Sbjct: 253 RICGKSYARPSTLKTHLRTHSGEKPYRCIDCNKSFSQAANLTAHVRTH 300 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 663 NRDYSMAXTLSXTMDSXGNRXAWGIQR 743 N DY + T+S + G +WG R Sbjct: 261 NMDYLSSSTMSHSQFGNGLETSWGKSR 287 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 596 MVLGPSGTWFPLN 634 ++ GPS TWF N Sbjct: 1138 VIYGPSDTWFDEN 1150 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 214 ELTLVIGVD*FASFNSRVVISN 149 EL IGV F SF+ V +SN Sbjct: 44 ELIKQIGVKEFDSFHDHVSVSN 65 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,472 Number of Sequences: 336 Number of extensions: 3433 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -